Hmdb loader
Identification
HMDB Protein ID HMDBP10700
Secondary Accession Numbers
  • 16961
Name HERV-K_5q33.3 provirus ancestral Pro protein
Synonyms
  1. HERV-K10 Pro protein
  2. HERV-K107 Pro protein
  3. PR
  4. Protease
  5. Proteinase
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Retroviral proteases have roles in processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution. This endogenous protein has retained most of the characteristics of retroviral proteases
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
binding
catalytic activity
hydrolase activity
aspartic-type endopeptidase activity
nucleic acid binding
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 156
Molecular Weight 17107.6
Theoretical pI 5.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>HERV-K_5q33.3 provirus ancestral Pro protein
WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASE
VYQSMEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMT
KMGYIPGKGLGKNEDGIKVPVEAKINQEREGIGYPF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P10265
UniProtKB/Swiss-Prot Entry Name VPK10_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  2. Ono M, Yasunaga T, Miyata T, Ushikubo H: Nucleotide sequence of human endogenous retrovirus genome related to the mouse mammary tumor virus genome. J Virol. 1986 Nov;60(2):589-98. [PubMed:3021993 ]
  3. Barbulescu M, Turner G, Seaman MI, Deinard AS, Kidd KK, Lenz J: Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans. Curr Biol. 1999 Aug 26;9(16):861-8. [PubMed:10469592 ]
  4. Schommer S, Sauter M, Krausslich HG, Best B, Mueller-Lantzsch N: Characterization of the human endogenous retrovirus K proteinase. J Gen Virol. 1996 Feb;77 ( Pt 2 ):375-9. [PubMed:8627242 ]
  5. Towler EM, Gulnik SV, Bhat TN, Xie D, Gustschina E, Sumpter TR, Robertson N, Jones C, Sauter M, Mueller-Lantzsch N, Debouck C, Erickson JW: Functional characterization of the protease of human endogenous retrovirus, K10: can it complement HIV-1 protease? Biochemistry. 1998 Dec 8;37(49):17137-44. [PubMed:9860826 ]
  6. Kuhelj R, Rizzo CJ, Chang CH, Jadhav PK, Towler EM, Korant BD: Inhibition of human endogenous retrovirus-K10 protease in cell-free and cell-based assays. J Biol Chem. 2001 May 18;276(20):16674-82. Epub 2001 Feb 21. [PubMed:11278433 ]