Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10701
Secondary Accession Numbers
  • 16962
Name Alpha-(1,3)-fucosyltransferase
Synonyms
  1. Fuc-TVII
  2. FucT-VII
  3. Fucosyltransferase 7
  4. Fucosyltransferase VII
  5. Galactoside 3-L-fucosyltransferase
  6. Selectin ligand synthase
Gene Name FUT7
Protein Type Enzyme
Biological Properties
General Function Involved in fucosyltransferase activity
Specific Function May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.
Pathways
  • Glycosphingolipid biosynthesis - lacto and neolacto series
  • Other types of O-glycan biosynthesis
  • protein glycosylation
Reactions
GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R → Guanosine diphosphate + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R details
GDP-L-fucose + Sialyl-3-paragloboside → GDP + IV3NeuAc,III3Fuc-nLc4Cer details
GO Classification
Biological Process
L-fucose catabolic process
CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation
leukocyte migration involved in immune response
protein glycosylation
Cellular Component
Golgi cisterna membrane
Golgi apparatus
integral to membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
fucosyltransferase activity
Molecular Function
alpha-(1->3)-fucosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Single-pass type II membrane protein
  2. Golgi apparatus
  3. Golgi stack membrane
Gene Properties
Chromosome Location 9
Locus 9q34.3
SNPs FUT7
Gene Sequence
>1029 bp
ATGAATAATGCTGGGCACGGCCCCACCCGGAGGCTGCGAGGCTTGGGGGTCCTGGCCGGG
GTGGCTCTGCTCGCTGCCCTCTGGCTCCTGTGGCTGCTGGGGTCAGCCCCTCGGGGTACC
CCGGCACCCCAGCCCACGATCACCATCCTTGTCTGGCACTGGCCCTTCACTGACCAGCCC
CCAGAGCTGCCCAGCGACACCTGCACCCGCTACGGCATCGCCCGCTGCCACCTGAGTGCC
AACCGAAGCCTGCTGGCCAGCGCCGACGCCGTGGTCTTCCACCACCGCGAGCTGCAGACC
CGGCGGTCCCACCTGCCCCTGGCCCAGCGGCCGCGAGGGCAGCCCTGGGTGTGGGCCTCC
ATGGAGTCTCCTAGCCACACCCACGGCCTCAGCCACCTCCGAGGCATCTTCAACTGGGTG
CTGAGCTACCGGCGCGACTCGGACATCTTTGTGCCCTATGGCCGCCTGGAGCCCCACTGG
GGGCCCTCGCCACCGCTGCCAGCCAAGAGCAGGGTGGCCGCCTGGGTGGTCAGCAACTTC
CAGGAGCGGCAGCTGCGTGCCAGGCTGTACCGGCAGCTGGCGCCTCATCTGCGGGTGGAT
GTCTTTGGCCGTGCCAATGGACGGCCACTGTGCGCCAGCTGCCTGGTGCCCACCGTGGCC
CAGTACCGCTTCTACCTGTCCTTTGAGAACTCTCAGCACCGCGACTACATTACGGAGAAA
TTCTGGCGCAACGCACTGGTGGCTGGCACTGTGCCAGTGGTGCTGGGGCCCCCACGGGCC
ACCTATGAGGCCTTCGTGCCGGCTGACGCCTTCGTGCATGTGGATGACTTTGGCTCAGCC
CGAGAGCTGGCGGCTTTCCTCACTGGCATGAATGAGAGCCGATACCAACGCTTCTTTGCC
TGGCGTGACAGGCTCCGCGTGCGACTGTTCACCGACTGGCGGGAACGTTTCTGTGCCATC
TGTGACCGCTACCCACACCTACCCCGCAGCCAAGTCTATGAGGACCTTGAGGGTTGGTTT
CAGGCCTGA
Protein Properties
Number of Residues 342
Molecular Weight 39238.495
Theoretical pI 10.035
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-(1,3)-fucosyltransferase
MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
GenBank ID Protein 3551241
UniProtKB/Swiss-Prot ID Q11130
UniProtKB/Swiss-Prot Entry Name FUT7_HUMAN
PDB IDs Not Available
GenBank Gene ID AB012668
GeneCard ID FUT7
GenAtlas ID FUT7
HGNC ID HGNC:4018
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. Natsuka S, Gersten KM, Zenita K, Kannagi R, Lowe JB: Molecular cloning of a cDNA encoding a novel human leukocyte alpha-1,3-fucosyltransferase capable of synthesizing the sialyl Lewis x determinant. J Biol Chem. 1994 Jun 17;269(24):16789-94. [PubMed:8207002 ]
  5. Natsuka S, Gersten KM, Zenita K, Kannagi R, Lowe JB: Molecular cloning of a cDNA encoding a novel human leukocyte alpha-1,3-fucosyltransferase capable of synthesizing the sialyl Lewis x determinant. J Biol Chem. 1994 Aug 12;269(32):20806. [PubMed:8051184 ]
  6. Sasaki K, Kurata K, Funayama K, Nagata M, Watanabe E, Ohta S, Hanai N, Nishi T: Expression cloning of a novel alpha 1,3-fucosyltransferase that is involved in biosynthesis of the sialyl Lewis x carbohydrate determinants in leukocytes. J Biol Chem. 1994 May 20;269(20):14730-7. [PubMed:8182079 ]
  7. de Vries T, Yen TY, Joshi RK, Storm J, van Den Eijnden DH, Knegtel RM, Bunschoten H, Joziasse DH, Macher BA: Neighboring cysteine residues in human fucosyltransferase VII are engaged in disulfide bridges, forming small loop structures. Glycobiology. 2001 May;11(5):423-32. [PubMed:11425803 ]