Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10711
Secondary Accession Numbers
  • 16972
Name Ornithine decarboxylase antizyme 3
Synonyms
  1. AZ3
  2. ODC-Az 3
Gene Name OAZ3
Protein Type Enzyme
Biological Properties
General Function Involved in enzyme inhibitor activity
Specific Function Binds to, and destabilizes, ornithine decarboxylase. Does not accelerate ornithine decarboxylase degeneration. OAZ3 probably plays a key role in spermatogenesis by regulating the intracellular concentration of polyamines in haploid germ cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
enzyme regulator activity
enzyme inhibitor activity
ornithine decarboxylase inhibitor activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.3
SNPs OAZ3
Gene Sequence
>564 bp
ATGCTGCCTCGTTGTTATAAAAGCATCACTTATAAGGAAGAGGAGGACTTGACACTCCAG
CCCCGTTCCTGCCTCCAGTGCTCTGAGTCCCTAGTAGGCCTCCAGGAGGGCAAAAGCACC
GAGCAGGGTAACCACGACCAGCTTAAAGAACTGTATTCGGCTGGGAACTTGACGGTGCTG
GCTACTGACCCCCTGCTCCACCAGGACCCAGTACAGTTAGACTTTCACTTCCGCCTTACC
TCCCAGACCTCTGCCCATTGGCACGGCCTTCTCTGTGACCGTCGACTCTTCCTGGATATC
CCATATCAGGCCTTGGATCAAGGCAACCGGGAAAGTTTGACTGCAACCCTGGAGTACGTG
GAAGAGAAGACAAATGTGGACTCTGTGTTTGTGAACTTCCAGAATGATCGGAACGACAGA
GGTGCCCTGCTGCGGGCCTTCAGCTACATGGGCTTTGAGGTGGTCAGACCAGATCACCCT
GCCCTCCCTCCCTTGGACAATGTCATCTTTATGGTGTATCCCCTTGAAAGGGATGTTGGC
CACCTGCCCAGTGAGCCTCCTTGA
Protein Properties
Number of Residues 187
Molecular Weight 21374.8
Theoretical pI 4.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ornithine decarboxylase antizyme 3
MLPRCYKSITYKEEEDLTLQPRSCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVL
ATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLCDRRLFLDIPYQALDQGNRESLTATLEYV
EEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVG
HLPSEPP
GenBank ID Protein 5802609
UniProtKB/Swiss-Prot ID Q9UMX2
UniProtKB/Swiss-Prot Entry Name OAZ3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF175296
GeneCard ID OAZ3
GenAtlas ID OAZ3
HGNC ID HGNC:8097
References
General References
  1. Ivanov IP, Rohrwasser A, Terreros DA, Gesteland RF, Atkins JF: Discovery of a spermatogenesis stage-specific ornithine decarboxylase antizyme: antizyme 3. Proc Natl Acad Sci U S A. 2000 Apr 25;97(9):4808-13. [PubMed:10781085 ]