Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10712
Secondary Accession Numbers
  • 16973
Name Antizyme inhibitor 1
Synonyms
  1. AZI
  2. Ornithine decarboxylase antizyme inhibitor
Gene Name AZIN1
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Regulates cellular polyamine homeostasis. Inhibits antizyme-dependent ornithine decarboxylase degradation by binding to antizyme
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
polyamine metabolic process
polyamine biosynthetic process
cellular amino acid and derivative metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q22.3
SNPs AZIN1
Gene Sequence
>1347 bp
ATGAAAGGATTTATTGATGATGCAAACTACTCCGTTGGCCTGTTGGATGAAGGAACAAAC
CTTGGAAATGTTATTGATAACTATGTTTATGAACATACCCTGACAGGGAAAAATGCATTT
TTTGTGGGAGATCTTGGAAAGATTGTGAAGAAACACAGTCAATGGCAGAATGTAGTGGCT
CAGATAAAGCCATTCTACACAGTGAAGTGCAACTCTGCTCCAGCTGTACTTGAGATTTTG
GCAGCTCTTGGAACCGGATTTGCTTGTTCCAGTAAAAATGAAATGGCTTTAGTGCAAGAG
TTGGGTGTACCTCCAGAAAACATTATTTACATAAGTCCTTGCAAGCAAGTGTCTCAGATA
AAGTATGCAGCAAAAGTTGGAGTGAATATCCTGACATGTGACAATGAAATTGAATTGAAG
AAAATTGCACGTAATCACCCAAATGCCAAGGTCTTACTACATATTGCAACAGAAGATAAT
ATTGGAGGTGAAGAGGGTAACATGAAGTTTGGCACTACCCTGAAGAACTGTAGGCATCTC
TTGGAATGTGCTAAGGAACTTGATGTCCAAATAATTGGGGTTAAATTTCATGTTTCGAGT
GCTTGCAAAGAATCTCAAGTATATGTACATGCTCTATCTGATGCTCGATGTGTGTTTGAC
ATGGCTGGAGAAATTGGCTTTACGATGAACATGTTAGACATTGGTGGAGGATTCACGGGA
ACTGAATTTCAATTGGAAGAGGTTAATCATGTTATCAGCCCTCTGTTGGATATCTACTTT
CCTGAAGGATCTGGTGTTAAGATAATTTCAGAACCCGGAAGCTACTATGTGTCTTCTGCA
TTTACACTCGCAGTTAATATCATAGCAAAGAAAGTTGTTGAAAATGATAAATTTCCCTCT
GGAGTAGAAAAAACCGGAAGTGATGAACCAGCCTTCATGTATTATATGAATGATGGTGTT
TATGGTTCTTTTGCAAGTAAACTGTCTGAGGACTTAAATACCATTCCAGAGGTTCACAAG
AAATACAAGGAAGATGAGCCTCTGTTTACAAGCAGCCTTTGGGGTCCATCCTGTGATGAG
CTTGATCAAATTGTGGAAAGCTGTCTTCTTCCTGAGCTGAATGTGGGAGATTGGCTTATC
TTTGATAACATGGGAGCAGATTCTTTCCATGAACCATCTGCTTTTAATGATTTTCAGAGG
CCAGCCATTTATTACATGATGTCATTCAGTGATTGGTATGAGATGCAAGATGCTGGAATT
ACTTCAGACTCAATGATGAAGAACTTCTTCTTTGTGCCTTCTTGCATTCAGCTGAGCCAA
GAAGACAGCTTTTCCGCTGAAGCTTAA
Protein Properties
Number of Residues 448
Molecular Weight 49534.8
Theoretical pI 4.4
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Antizyme inhibitor 1
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQI
KYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDSMMKNFFFVPSCIQLSQEDSFSAEA
GenBank ID Protein 21361583
UniProtKB/Swiss-Prot ID O14977
UniProtKB/Swiss-Prot Entry Name AZIN1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015878.4
GeneCard ID AZIN1
GenAtlas ID AZIN1
HGNC ID HGNC:16432
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  3. Koguchi K, Kobayashi S, Hayashi T, Matsufuji S, Murakami Y, Hayashi S: Cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme inhibitor. Biochim Biophys Acta. 1997 Sep 12;1353(3):209-16. [PubMed:9349715 ]