You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10720
Secondary Accession Numbers
  • 16982
Name Selenoprotein S
Synonyms
  1. SelS
  2. VCP-interacting membrane protein
Gene Name SELS
Protein Type Unknown
Biological Properties
General Function Involved in selenium binding
Specific Function Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to endoplasmic reticulum membrane
integral to endoplasmic reticulum membrane
Function
binding
selenium binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.3
SNPs SELS
Gene Sequence
>570 bp
ATGGAACGCCAAGAGGAGTCTCTGTCCGCGCGGCCGGCCCTGGAGACCGAGGGGCTGCGC
TTCCTGCACACCACGGTGGGCTCCCTGCTGGCCACCTATGGCTGGTACATCGTCTTCAGC
TGCATCCTTCTCTACGTGGTCTTTCAGAAGCTTTCCGCCCGGCTAAGAGCCTTGAGGCAG
AGGCAGCTGGACCGAGCTGCGGCTGCTGTGGAACCTGATGTTGTTGTTAAACGACAAGAA
GCTTTAGCAGCTGCTCGACTGAAAATGCAAGAAGAACTAAATGCGCAAGTTGAAAAGCAT
AAGGAAAAACTGAAACAACTTGAAGAAGAAAAAAGGAGACAGAAGATTGAAATGTGGGAC
AGCATGCAAGAAGGAAAAAGTTACAAAGGAAATGCAAAGAAGCCCCAGGAGGAAGACAGT
CCTGGGCCTTCCACTTCATCTGTCCTGAAACGGAAATCGGACAGAAAGCCTTTGCGGGGA
GGAGGTTATAACCCGTTGTCTGGTGAAGGAGGCGGAGCTTGCTCCTGGAGACCTGGACGC
AGAGGCCCGTCATCTGGCGGATGAGGCTAA
Protein Properties
Number of Residues 189
Molecular Weight 21162.8
Theoretical pI 10.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 28-48
Protein Sequence
>Selenoprotein S
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQ
RQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD
SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
RGPSSGGUG
GenBank ID Protein 33285002
UniProtKB/Swiss-Prot ID Q9BQE4
UniProtKB/Swiss-Prot Entry Name SELS_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018445.4
GeneCard ID SELS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guigo R, Gladyshev VN: Characterization of mammalian selenoproteomes. Science. 2003 May 30;300(5624):1439-43. [PubMed:12775843 ]
  5. Ye Y, Shibata Y, Kikkert M, van Voorden S, Wiertz E, Rapoport TA: Recruitment of the p97 ATPase and ubiquitin ligases to the site of retrotranslocation at the endoplasmic reticulum membrane. Proc Natl Acad Sci U S A. 2005 Oct 4;102(40):14132-8. Epub 2005 Sep 26. [PubMed:16186510 ]
  6. Lilley BN, Ploegh HL: Multiprotein complexes that link dislocation, ubiquitination, and extraction of misfolded proteins from the endoplasmic reticulum membrane. Proc Natl Acad Sci U S A. 2005 Oct 4;102(40):14296-301. Epub 2005 Sep 26. [PubMed:16186509 ]
  7. Ye Y, Shibata Y, Yun C, Ron D, Rapoport TA: A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. Nature. 2004 Jun 24;429(6994):841-7. [PubMed:15215856 ]