You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10723
Secondary Accession Numbers
  • 16985
Name Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
Synonyms
  1. 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
  2. ADP-ribosylation factor-directed GTPase-activating protein 1
  3. ARF GTPase-activating protein 1
  4. DEF-1
  5. Development and differentiation-enhancing factor 1
  6. Differentiation-enhancing factor 1
  7. PIP2-dependent ARF1 GAP
Gene Name ASAP1
Protein Type Unknown
Biological Properties
General Function Involved in ARF GTPase activator activity
Specific Function Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
enzyme regulator activity
arf gtpase activator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of cellular metabolic process
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
regulation of nucleotide metabolic process
regulation of nucleotide catabolic process
regulation of purine nucleotide catabolic process
regulation of gtp catabolic process
regulation of gtpase activity
regulation of ras gtpase activity
regulation of arf gtpase activity
Cellular Location
  1. Cytoplasm
  2. Membrane
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.1-q24.2
SNPs ASAP1
Gene Sequence
>3390 bp
ATGAGATCTTCAGCCTCCAGGCTCTCCAGTTTTTCGTCGAGAGATTCACTATGGAATCGG
ATGCCGGACCAGATCTCTGTCTCGGAGTTCATCGCCGAGACCACCGAGGACTACAACTCG
CCCACCACGTCCAGCTTCACCACGCGGCTGCACAACTGCAGGAACACCGTCACGCTGCTG
GAGGAGGCTCTAGACCAAGATAGAACAGCCCTTCAGAAAGTGAAGAAGTCTGTAAAAGCA
ATATATAATTCTGGTCAAGATCATGTACAAAATGAAGAAAACTATGCACAAGTTCTTGAT
AAGTTTGGGAGTAATTTTTTAAGTCGAGACAACCCCGACCTTGGCACCGCGTTTGTCAAG
TTTTCTACTCTTACAAAGGAACTGTCCACACTGCTGAAAAATCTGCTCCAGGGTTTGAGC
CACAATGTGATCTTCACCTTGGATTCTTTGTTAAAAGGAGACCTAAAGGGAGTCAAAGGA
GATCTCAAGAAGCCATTTGACAAAGCCTGGAAAGATTATGAGACAAAGTTTACAAAAATT
GAGAAAGAGAAAAGAGAGCACGCAAAACAACATGGGATGATCCGCACAGAGATAACAGGA
GCTGAGATTGCGGAAGAAATGGAGAAGGAAAGGCGCCTCTTTCAGCTCCAAATGTGTGAA
TATCTCATTAAAGTTAATGAAATCAAGACCAAAAAGGGTGTGGATCTGCTGCAGAATCTT
ATAAAGTATTACCATGCACAGTGCAATTTCTTTCAAGATGGCTTGAAAACAGCTGATAAG
TTGAAACAGTACATTGAAAAACTGGCTGCTGATTTATATAATATAAAACAGACCCAGGAT
GAAGAAAAGAAACAGCTAACTGCACTCCGAGACTTAATAAAATCCTCTCTTCAACTGGAT
CAGAAAGAAGATTCTCAGAGCCGGCAAGGAGGATACAGCATGCATCAGCTCCAGGGCAAT
AAGGAATATGGCAGTGAAAAGAAGGGGTACCTGCTAAAGAAAAGTGACGGGATCCGGAAA
GTATGGCAGAGGAGGAAGTGTTCAGTCAAGAATGGGATTCTGACCATCTCACATGCCACA
TCTAACAGGCAACCAGCCAAGTTGAACCTTCTCACCTGCCAAGTAAAACCTAATGCCGAA
GACAAAAAATCTTTTGACCTGATATCACATAATAGAACATATCACTTTCAGGCAGAAGAT
GAGCAGGATTATGTAGCATGGATATCAGTATTGACAAATAGCAAAGAAGAGGCCCTAACC
ATGGCCTTCCGTGGAGAGCAGAGTGCGGGAGAGAACAGCCTGGAAGACCTGACAAAAGCC
ATTATTGAGGATGTCCAGCGGCTCCCAGGGAATGACATTTGCTGCGATTGTGGCTCATCA
GAACCCACCTGGCTTTCAACCAACTTGGGTATTTTGACCTGTATAGAATGTTCTGGCATC
CATAGGGAAATGGGGGTTCATATTTCTCGCATTCAGTCTTTGGAACTAGACAAATTAGGA
ACTTCTGAACTCTTGCTGGCCAAGAATGTAGGAAACAATAGTTTTAATGATATTATGGAA
GCAAATTTACCCAGCCCCTCACCAAAACCCACCCCTTCAAGTGATATGACTGTACGAAAA
GAATATATCACTGCAAAGTATGTAGATCATAGGTTTTCAAGGAAGACCTGTTCAACTTCA
TCAGCTAAACTAAATGAATTGCTTGAGGCCATCAAATCCAGGGATTTACTTGCACTAATT
CAAGTCTATGCAGAAGGGGTAGAGCTAATGGAACCACTGCTGGAACCTGGGCAGGAGCTT
GGGGAGACAGCCCTTCACCTTGCCGTCCGAACTGCAGATCAGACATCTCTCCATTTGGTT
GACTTCCTTGTACAAAACTGTGGGAACCTGGATAAGCAGACGGCCCTGGGAAACACAGTT
CTACACTACTGTAGTATGTACAGTAAACCTGAGTGTTTGAAGCTTTTGCTCAGGAGCAAG
CCCACTGTGGATATAGTTAACCAGGCTGGAGAAACTGCCCTAGACATAGCAAAGAGACTA
AAAGCTACCCAGTGTGAAGATCTGCTTTCCCAGGCTAAATCTGGAAAGTTCAATCCACAC
GTCCACGTAGAATATGAGTGGAATCTTCGACAGGAGGAGATAGATGAGAGCGATGATGAT
CTGGATGACAAACCAAGCCCTATCAAGAAAGAGCGCTCACCCAGACCTCAGAGCTTCTGC
CACTCCTCCAGCATCTCCCCCCAGGACAAGCTGGCACTGCCAGGATTCAGCACTCCAAGG
GACAAACAGCGGCTCTCCTATGGAGCCTTCACCAACCAGATCTTCGTTTCCACAAGCACA
GACTCGCCCACATCACCAACCACGGAGGCTCCCCCTCTGCCTCCTAGGAACGCCGGGAAA
GGTCCAACTGGCCCACCTTCAACACTCCCTCTAAGCACCCAGACCTCTAGTGGCAGCTCC
ACCCTATCCAAGAAGAGGCCTCCTCCCCCACCACCCGGACACAAGAGAACCCTATCCGAC
CCTCCCAGCCCACTACCTCATGGGCCCCCAAACAAAGGCGCAGTTCCTTGGGGTAACGAT
GGGGGTCCATCCTCTTCAAGTAAGACTACAAACAAGTTTGAGGGACTATCCCAGCAGTCG
AGCACCAGTTCTGCAAAGACTGCCCTTGGCCCAAGAGTTCTTCCTAAACTACCTCAGAAA
GTGGCACTAAGGAAAACAGATCATCTCTCCCTAGACAAAGCCACCATCCCGCCCGAAATC
TTTCAGAAATCATCACAGTTGGCAGAGTTGCCACAAAAGCCACCACCTGGAGACCTGCCC
CCAAAGCCCACAGAACTGGCCCCCAAGCCCCAAATTGGAGATTTGCCGCCTAAGCCAGGA
GAACTGCCCCCCAAACCACAGCTGGGGGACCTGCCACCCAAACCCCAACTCTCAGACTTA
CCTCCCAAACCACAGATGAAGGACCTGCCCCCCAAACCACAGCTGGGAGACCTGCTAGCA
AAATCCCAGACTGGAGATGTCTCACCCAAGGCTCAGCAACCCTCTGAGGTCACACTGAAG
TCACACCCATTGGATCTATCCCCAAATGTGCAGTCCAGAGACGCCATCCAAAAGCAAGCA
TCTGAAGACTCCAACGACCTCACGCCTACTCTGCCAGAGACGCCCGTACCACTGCCCAGA
AAAATCAATACGGGGAAAAATAAAGTGAGGCGAGTGAAGACCATTTATGACTGCCAGGCA
GACAACGATGACGAGCTCACATTCATCGAGGGAGAAGTGATTATCGTCACAGGGGAAGAG
GACCAGGAGTGGTGGATTGGCCACATCGAAGGACAGCCTGAAAGGAAGGGGGTCTTTCCA
GTGTCCTTTGTTCATATCCTGTCTGACTAG
Protein Properties
Number of Residues 1129
Molecular Weight 125496.9
Theoretical pI 7.34
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
GenBank ID Protein 46094081
UniProtKB/Swiss-Prot ID Q9ULH1
UniProtKB/Swiss-Prot Entry Name ASAP1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018482.2
GeneCard ID ASAP1
GenAtlas ID ASAP1
HGNC ID HGNC:2720
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  7. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]
  8. Brown MT, Andrade J, Radhakrishna H, Donaldson JG, Cooper JA, Randazzo PA: ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. Mol Cell Biol. 1998 Dec;18(12):7038-51. [PubMed:9819391 ]