Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10747
Secondary Accession Numbers
  • 17011
Name Sodium bicarbonate transporter-like protein 11
Synonyms
  1. Bicarbonate transporter-related protein 1
  2. NaBC1
  3. Sodium borate cotransporter 1
  4. Solute carrier family 4 member 11
Gene Name SLC4A11
Protein Type Unknown
Biological Properties
General Function Involved in anion transport
Specific Function Transporter which plays an important role in sodium-mediated fluid transport in different organs. Prevents severe morphological changes of the cornea caused by increased sodium chloride concentrations in the stroma. In the inner ear, is involved in transport of potassium through the fibrocyte layer to the stria vascularis and is essential for the generation of the endocochlear potential but not for regulation of potassium concentrations in the endolymph. In the kidney, is essential for urinary concentration, mediates a sodium flux into the thin descending limb of Henle loop to allow countercurrent multiplication by osmotic equilibration (By similarity). Involved in borate homeostasis. In the absence of borate, it functions as a Na(+) and OH(-)(H(+)) channel. In the presence of borate functions as an electrogenic Na(+) coupled borate cotransporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
cellular cation homeostasis
fluid transport
phosphoenolpyruvate-dependent sugar phosphotransferase system
Cellular Component
basolateral plasma membrane
integral to membrane
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion exchanger activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
anion:anion antiporter activity
solute:cation symporter activity
cation:sugar symporter activity
sugar:hydrogen symporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
bicarbonate transmembrane transporter activity
borate transmembrane transporter activity
sugar:hydrogen symporter activity
hydrogen ion channel activity
inorganic anion exchanger activity
sodium channel activity
protein dimerization activity
Process
phosphoenolpyruvate-dependent sugar phosphotransferase system
establishment of localization
transport
carbohydrate transport
anion transport
ion transport
Cellular Location
  1. Cell membrane
  2. Membrane
  3. Multi-pass membrane protein
Gene Properties
Chromosome Location 20
Locus 20p12
SNPs SLC4A11
Gene Sequence
>2676 bp
ATGAGCCAGGTCGGGGGGCGGGGAGACAGGTGCACACAGGAGGTCCAGGGCTTGGTCCAT
GGGGCTGGTGACCTTTCTGCTTCCCTTGCAGAAAACTCTCCCACCATGTCGCAGAATGGA
TACTTCGAGGATTCAAGCTACTACAAGTGTGACACAGATGACACCTTCGAAGCCCGAGAG
GAGATCCTGGGGGATGAGGCCTTCGACACTGCCAACTCCTCCATCGTGTCTGGCGAGAGT
ATCCGTTTTTTTGTCAATGTCAACCTTGAGATGCAGGCCACCAACACTGAGAATGAAGCG
ACTTCCGGTGGCTGTGTGCTCCTGCACACCTCCCGAAAGTACCTGAAGTTAAAGAACTTC
AAGGAAGAGATCCGTGCGCACCGCGACCTAGATGGCTTCCTGGCGCAGGCCAGCATCGTC
CTGAACGAGACGGCCACCTCCCTGGATAACGTGCTGCGGACCATGCTTCGCCGCTTCGCC
AGGGACCCTGACAACAATGAGCCCAACTGCAACCTGGACCTGCTCATGGCCATGCTCTTC
ACCGATGCCGGGGCACCCATGCGGGGTAAAGTCCACCTGCTGTCAGATACCATCCAAGGG
GTCACCGCCACAGTGACAGGGGTGCGGTACCAGCAGTCGTGGCTCTGCATCATCTGTACC
ATGAAGGCCCTACAGAAGCGGCACGTGTGCATCAGCCGCCTGGTTCGCCCACAGAACTGG
GGGGAGAATTCCTGTGAGGTTCGGTTCGTCATCCTGGTGCTGGCCCCACCCAAGATGAAA
AGCACTAAGACTGCGATGGAGGTGGCGCGCACGTTTGCCACCATGTTCTCGGATATCGCC
TTCCGCCAGAAGCTCCTGGAGACCCGCACAGAGGAGGAATTCAAGGAGGCCTTGGTGCAT
CAGAGACAGCTGCTCACCATGGTGAGCCACGGTCCAGTGGCGCCGAGAACGAAGGAACGC
AGCACAGTCTCCCTCCCTGCCCACAGACACCCAGAGCCCCCAAAGTGCAAGGACTTTGTC
CCTTTTGGGAAGGGCATCCGGGAGGACATCGCACGCAGGTTCCCCTTGTACCCCTTGGAC
TTCACTGATGGCATTATTGGGAAAAACAAGGCTGTGGGCAAATACATCACCACCACCCTG
TTCCTCTACTTCGCCTGCCTCCTGCCCACCATCGCTTTCGGGTCTCTCAATGACGAGAAC
ACAGACGGGGCCATCGACGTGCAGAAGACCATAGCCGGGCAGAGCATCGGGGGCCTGCTC
TACGCGCTCTTCTCTGGGCAGCCATTGGTGATTCTGCTGACCACCGCGCCCCTGGCGCTC
TACATCCAGGTGATTCGTGTCATCTGTGATGACTATGACCTGGACTTCAACTCCTTCTAC
GCATGGACGGGCCTGTGGAATAGTTTCTTCCTTGCGCTTTATGCCTTTTTCAACCTCAGC
CTGGTCATGAGTCTCTTCAAGAGGTCGACGGAGGAGATCATCGCCCTCTTCATTTCCATC
ACGTTTGTGCTGGATGCCGTCAAGGGCACGGTTAAAATCTTCTGGAAGTACTACTATGGG
CATTACTTGGACGACTATCACACAAAAAGGACTTCATCCCTTGTCAGCCTGTCAGGCCTC
GGCGCCAGCCTCAACGCCAGCCTCCACACTGCCCTCAACGCCAGCTTCCTCGCCAGCCCC
ACGGAGCTGCCCTCGGCCACACACTCAGGCCAGGCGACCGCCGTGCTCAGCCTCCTCATC
ATGCTGGGCACGCTCTGGCTGGGCTACACCCTCTACCAATTCAAGAAGAGCCCCTACCTG
CACCCCTGCGTGCGAGAGATCCTGTCCGACTGCGCCCTGCCCATCGCGGTGCTCGCCTTC
TCCCTCATCAGCTCCCATGGCTTCCGGGAAATCGAGATGAGCAAGTTCCGCTACAACCCC
AGCGAGAGCCCCTTTGCGATGGCGCAGATCCAGTCGCTGTCCCTGAGGGCCGTCAGCGGT
GCCATGGGCCTCGGCTTCCTGCTGTCCATGCTCTTCTTCATCGAGCAGAACTTGGTGGCC
GCCTTGGTGAATGCACCGGAGAACAGGCTGGTGAAGGGCACTGCCTACCACTGGGACCTC
CTGCTCCTCGCCATCATCAACACAGGGCTGTCTCTGTTTGGGCTGCCTTGGATCCATGCC
GCCTACCCCCACTCCCCGCTGCACGTGCGAGCCCTGGCCTTAGTGGAGGAGCGTGTGGAG
AACGGACACATCTATGACACGATTGTGAACGTGAAGGAGACGCGGCTGACCTCGCTGGGC
GCCAGCGTCCTGGTGGGCCTGTCCCTGTTGCTGCTGCCGGTCCCGCTTCAGTGGATCCCC
AAGCCCGTGCTCTATGGCCTCTTCCTCTACATCGCGCTCACCTCCCTCGATGGCAACCAG
CTCGTCCAGCGCGTGGCCCTGCTGCTCAAGGAGCAGACTGCGTACCCCCCGACACACTAC
ATCCGGAGGGTGCCCCAGAGGAAGATCCACTACTTCACGGGCCTGCAGGTGCTTCAGCTG
CTGCTGCTGTGTGCCTTCGGCATGAGCTCCCTGCCCTACATGAAGATGATCTTTCCCCTC
ATCATGATCGCCATGATCCCCATCCGCTATATCCTGCTGCCCCGAATCATTGAAGCCAAG
TACTTGGATGTCATGGACGCTGAGCACAGGCCTTGA
Protein Properties
Number of Residues 891
Molecular Weight 98180.24
Theoretical pI 8.018
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium bicarbonate transporter-like protein 11
MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEARE
EILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNF
KEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF
TDAGAPMRGKVHLLSDTIQGVTATVTGVRYQQSWLCIICTMKALQKRHVCISRLVRPQNW
GENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVH
QRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLD
FTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLL
YALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLS
LVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGL
GASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYL
HPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSG
AMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHA
AYPHSPLHVRALALVEERVENGHIYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIP
KPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQL
LLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMDAEHRP
GenBank ID Protein 13249297
UniProtKB/Swiss-Prot ID Q8NBS3
UniProtKB/Swiss-Prot Entry Name S4A11_HUMAN
PDB IDs Not Available
GenBank Gene ID AF336127
GeneCard ID SLC4A11
GenAtlas ID SLC4A11
HGNC ID HGNC:16438
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  4. Parker MD, Ourmozdi EP, Tanner MJ: Human BTR1, a new bicarbonate transporter superfamily member and human AE4 from kidney. Biochem Biophys Res Commun. 2001 Apr 20;282(5):1103-9. [PubMed:11302728 ]
  5. Park M, Li Q, Shcheynikov N, Zeng W, Muallem S: NaBC1 is a ubiquitous electrogenic Na+ -coupled borate transporter essential for cellular boron homeostasis and cell growth and proliferation. Mol Cell. 2004 Nov 5;16(3):331-41. [PubMed:15525507 ]
  6. Vithana EN, Morgan PE, Ramprasad V, Tan DT, Yong VH, Venkataraman D, Venkatraman A, Yam GH, Nagasamy S, Law RW, Rajagopal R, Pang CP, Kumaramanickevel G, Casey JR, Aung T: SLC4A11 mutations in Fuchs endothelial corneal dystrophy. Hum Mol Genet. 2008 Mar 1;17(5):656-66. Epub 2007 Nov 16. [PubMed:18024964 ]
  7. Vithana EN, Morgan P, Sundaresan P, Ebenezer ND, Tan DT, Mohamed MD, Anand S, Khine KO, Venkataraman D, Yong VH, Salto-Tellez M, Venkatraman A, Guo K, Hemadevi B, Srinivasan M, Prajna V, Khine M, Casey JR, Inglehearn CF, Aung T: Mutations in sodium-borate cotransporter SLC4A11 cause recessive congenital hereditary endothelial dystrophy (CHED2). Nat Genet. 2006 Jul;38(7):755-7. Epub 2006 Jun 11. [PubMed:16767101 ]
  8. Jiao X, Sultana A, Garg P, Ramamurthy B, Vemuganti GK, Gangopadhyay N, Hejtmancik JF, Kannabiran C: Autosomal recessive corneal endothelial dystrophy (CHED2) is associated with mutations in SLC4A11. J Med Genet. 2007 Jan;44(1):64-8. Epub 2006 Jul 6. [PubMed:16825429 ]
  9. Desir J, Moya G, Reish O, Van Regemorter N, Deconinck H, David KL, Meire FM, Abramowicz MJ: Borate transporter SLC4A11 mutations cause both Harboyan syndrome and non-syndromic corneal endothelial dystrophy. J Med Genet. 2007 May;44(5):322-6. Epub 2007 Jan 12. [PubMed:17220209 ]