Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10751
Secondary Accession Numbers
  • 17018
Name Vasopressin-neurophysin
Synonyms Not Available
Gene Name Not Available
Protein Type Unknown
Biological Properties
General Function Involved in neurohypophyseal hormone activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
binding
protein binding
receptor binding
neuropeptide hormone activity
neurohypophyseal hormone activity
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>117 bp
ATGCCTGACACCATGCTGCCCGCCTGCTTCCTCGGCCTACTGGCCTTCTCCTCCGCGTGC
TACTTCCAGAACTGCCCGAGGGGCGGCAAGAGGGCCATGTCCGACCTGGAGCTGAGA
Protein Properties
Number of Residues 39
Molecular Weight 4312.0
Theoretical pI 8.04
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Vasopressin-neurophysin
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELR
GenBank ID Protein 2625108
UniProtKB/Swiss-Prot ID Q9UEW6
UniProtKB/Swiss-Prot Entry Name Q9UEW6_HUMAN
PDB IDs
GenBank Gene ID AF031475
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:894
References
General References
  1. Bahnsen U, Oosting P, Swaab DF, Nahke P, Richter D, Schmale H: A missense mutation in the vasopressin-neurophysin precursor gene cosegregates with human autosomal dominant neurohypophyseal diabetes insipidus. EMBO J. 1992 Jan;11(1):19-23. [PubMed:1740104 ]