Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10754
Secondary Accession Numbers
  • 17021
Name Kinesin-like protein KIF13A
Synonyms
  1. Kinesin-like protein RBKIN
Gene Name KIF13A
Protein Type Unknown
Biological Properties
General Function Involved in microtubule motor activity
Specific Function Plus end-directed microtubule-dependent motor protein involved in mannose-6-phosphate receptor (M6PR) transport to the plasma membrane
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
microtubule motor activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
microtubule-based process
microtubule-based movement
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:6
Locus 6p23
SNPs KIF13A
Gene Sequence
>5418 bp
ATGTCGGATACCAAGGTAAAAGTTGCCGTCCGGGTCCGGCCCATGAACCGACGAGAACTG
GAACTGAACACCAAGTGCGTGGTGGAGATGGAAGGGAATCAAACGGTCCTGCACCCTCCT
CCTTCTAACACCAAACAGGGAGAAAGGAAACCTCCCAAGGTATTTGCCTTTGATTATTGC
TTTTGGTCCATGGATGAATCTAACACTACAAAATACGCTGGTCAAGAAGTGGTTTTCAAG
TGCCTTGGGGAAGGAATTCTTGAAAAAGCCTTTCAGGGGTATAATGCGTGTATTTTTGCA
TATGGACAGACAGGTTCGGGAAAATCCTTTTCCATGATGGGCCATGCTGAGCAGCTGGGC
CTTATTCCAAGGCTCTGCTGTGCTTTATTTAAAAGGATCTCTTTGGAGCAAAATGAGTCA
CAGACCTTTAAAGTTGAAGTGTCCTATATGGAAATTTATAATGAGAAAGTTCGGGATCTT
TTAGACCCCAAAGGGAGTAGACAGTCTCTTAAAGTTCGAGAACATAAAGTTTTGGGACCA
TATGTAGATGGTTTATCTCAACTAGCTGTCACTAGTTTTGAGGATATTGAGTCATTGATG
TCTGAGGGAAATAAGTCTCGAACGGTAGCTGCTACCAACATGAACGAAGAAAGCAGCCGC
TCCCATGCTGTGTTCAACATCATAATCACACAGACACTTTATGACCTGCAGTCTGGGAAT
TCCGGGGAGAAAGTCAGTAAGGTCAGCTTGGTAGACCTGGCGGGTAGCGAAAGAGTATCT
AAAACAGGAGCTGCAGGAGAGCGACTGAAAGAAGGCAGCAACATTAACAAATCGCTTACA
ACCTTGGGGTTGGTTATATCATCACTGGCTGACCAGGCAGCTGGCAAGGGTAAAAGCAAA
TTTGTGCCTTATCGAGATTCAGTCCTCACTTGGCTGCTTAAGGACAACTTGGGGGGCAAC
AGCCAAACCTCTATGATAGCCACAATCAGCCCAGCCGCAGACAACTATGAAGAGACCCTC
TCCACATTAAGATATGCAGACCGAGCCAAAAGGATTGTGAACCATGCTGTTGTGAATGAG
GACCCCAACGCAAAAGTGATCCGAGAACTGCGGGAGGAAGTCGAGAAACTGAGAGAGCAG
CTCTCTCAGGCAGAGGCCATGAAGGCCCCTGAACTGAAGGAGAAGCTCGAAGAGTCTGAA
AAGCTGATAAAAGAACTAACAGTGACTTGGGAAGAGAAGCTGAGAAAAACAGAAGAGATA
GCACAGGAAAGACAACGACAACTTGAAAGCATGGGGATTTCCCTGGAGATGTCCGGTATC
AAGGTGGGGGATGACAAATGCTACTTAGTCAATCTGAATGCAGACCCTGCTCTTAACGAA
CTTCTGGTTTATTATTTAAAGGATCACACCAGGGTGGGTGCAGATACCTCTCAAGATATC
CAGCTTTTTGGCATAGGAATTCAGCCTCAGCACTGTGAGATTGACATTGCATCTGATGGA
GACGTCACTCTCACTCCAAAAGAAAATGCAAGGTCCTGTGTGAACGGCACCCTTGTGTGC
AGTACCACCCAGCTGTGGCATGGTGACCGAATCCTATGGGGAAATAATCACTTTTTTAGA
ATAAACTTACCTAAGAGGAAACGTCGAGATTGGTTGAAAGACTTTGAAAAAGAAACGGGC
CCGCCAGAGCATGACCTGGATGCAGCCAGTGAGGCTTCCTCTGAACCAGACTATAACTAT
GAATTTGCACAGATGGAAGTTATCATGAAAACCCTGAATAGTAATGACCCAGTTCAAAAT
GTGGTTCAGGTCCTGGAGAAACAATACCTAGAAGAAAAGAGAAGTGCCCTAGAGGAGCAG
CGGCTCATGTATGAGCGGGAACTGGAGCAACTCCGCCAGCAGCTCTCCCCCGACAGGCAG
CCACAGAGTAGCGGCCCTGACCGCCTGGCCTACAGCAGCCAGACAGCGCAGCAGAAGGTG
ACCCAGTGGGCAGAAGAGAGGGATGAACTCTTCCGACAAAGCCTGGCAAAACTGCGAGAG
CAGCTGGTTAAAGCTAATACCTTGGTGAGGGAAGCAAACTTCCTGGCTGAGGAAATGAGC
AAACTCACCGATTACCAAGTGACTCTTCAGATCCCTGCTGCAAACCTCAGTGCCAATAGG
AAGAGAGGTGCAATAGTGAGTGAACCAGCTATCCAAGTGAGGAGGAAAGGAAAGAGCACC
CAAGTGTGGACCATTGAGAAGCTGGAGAATAAATTAATTGACATGAGAGACCTTTACCAA
GAATGGAAGGAAAAAGTTCCTGAGGCAAAGAGACTCTACGGAAAACGAGGTGACCCTTTC
TATGAAGCCCAAGAAAATCACAACCTCATCGGGGTGGCGAATGTATTCTTGGAATGCCTC
TTCTGTGATGTGAAACTTCAGTATGCAGTCCCTATCATCAGCCAGCAGGGGGAGGTTGCA
GGGCGTCTCCACGTGGAAGTGATGCGTGTTACAGGAGCTGTTCCAGAGCGTGTGGTGGAG
GATGACTCTTCGGAGAATTCCAGTGAAAGTGGGAGCCTTGAAGTCGTAGACAGCAGCGGG
GAAATCATTCACCGAGTCAAAAAGCTGACATGTCGGGTAAAAATTAAAGAAGCAACGGGG
CTGCCCTTAAACCTCTCAAATTTTGTCTTCTGTCAATACACATTCTGGGACCAGTGTGAG
TCTACGGTGGCTGCCCCGGTGGTGGACCCCGAGGTGCCTTCACCACAGTCCAAGGATGCC
CAGTACACAGTGACCTTCTCCCACTGTAAGGACTATGTGGTGAATGTAACAGAAGAATTT
CTGGAGTTCATTTCAGATGGAGCACTGGCCATTGAAGTATGGGGCCACCGGTGTGCTGGA
AATGGCAGCTCCATCTGGGAGGTCGATTCTCTTCATGCTAAGACAAGAACACTGCATGAC
AGGTGGAATGAAGTAACGCGAAGAATAGAAATGTGGATCTCCATATTAGAATTGAATGAG
TTAGGAGAGTATGCTGCAGTGGAACTTCATCAGGCAAAAGATGTCAACACAGGAGGCATC
TTTCAACTTAGACAGGGTCATTCCCGTAGAGTACAAGTCACGGTGAAACCTGTGCAGCAT
TCAGGGACACTGCCACTTATGGTTGAAGCCATCCTGTCAGTATCCATCGGCTGTGTAACT
GCCAGGTCCACCAAACTCCAAAGAGGGCTGGACAGTTACCAGAGAGATGATGAGGATGGT
GATGATATGGATAGTTATCAGGAAGAAGACTTAAACTGCGTAAGGGAGAGGTGGTCAGAT
GCACTCATTAAACGACGAGAATACCTGGATGAACAGATAAAAAAAGTCAGCAATAAAACA
GAGAAAACAGAGGACGATGTGGAGCGGGAAGCCCAGCTTGTGGAGCAGTGGGTAGGGCTG
ACTGAGGAAAGGAATGCTGTGCTGGTGCCAGCCCCAGGCAGTGGGATTCCTGGGGCACCT
GCCGACTGGATCCCACCTCCTGGAATGGAAACCCACATACCAGTTCTCTTCCTCGATTTG
AATGCGGATGACCTCAGTGCCAATGAGCAGCTTGTTGGCCCCCATGCATCCGGCGTGAAC
TCCATCCTGCCCAAGGAGCATGGCAGCCAGTTTTTCTACCTGCCCATCATAAAGCACAGT
GATGATGAGGTTTCAGCCACAGCCTCTTGGGATTCCTCGGTGCATGATTCTGTTCACTTG
AATAGGGTCACACCACAGAATGAAAGGATTTACCTAATTGTGAAAACCACAGTTCAACTC
AGCCACCCTGCTGCTATGGAGTTAGTATTACGAAAACGAATTGCAGCCAATATTTACAAC
AAACAGAGTTTCACGCAGAGTTTGAAGAGGAGAATATCCCTGAAAAATATATTTTATTCC
TGTGGTGTAACCTATGAAATAGTATCCAATATACCAAAGGCAACTGAGGAGATAGAGGAC
CGGGAAACGCTGGCTCTCCTGGCAGCAAGGAGTGAAAACGAAGGCACATCAGATGGGGAG
ACGTACATTGAGAAGTACACTCGAGGCGTGCTGCAGGTGGAAAACATTCTGAGTCTTGAA
CGGCTCCGGCAGGCCGTCACAGTCAAAGAAGCACTTTCCACCAAAGCCCGGCACATTCGG
AGGAGCCTCAGTACACCAAATGTTCATAATGTCTCTTCCAGCCGACCGGACCTTTCTGGC
TTTGATGAAGATGACAAGGGTTGGCCAGAGAACCAGTTGGACATGTCTGACTATAGCTCC
AGTTACCAAGATGTAGCATGTTATGGAACTTTACCCAGGGATTCTCCTCGAAGGAATAAA
GAAGGTTGTACATCAGAGACTCCTCATGCCTTAACCGTCAGCCCTTTTAAAGCATTCTCT
CCTCAGCCACCAAAGTTTTTCAAGCCCCTAATGCCTGTAAAAGAGGAGCATAAGAAAAGG
ATAGCCCTGGAAGCAAGGCCTCTTCTAAGCCAGGAGAGCATGCCTCCACCTCAGGCACAT
AACCCTGGCTGCATTGTACCCTCAGGAAGCAATGGCAGCAGCATGCCAGTAGAACACAAT
AGCAAACGTGAGAAGAAGATTGACTCTGAGGAGGAAGAAAATGAGCTGGAAGCTATTAAC
AGGAAGCTAATAAGTTCACAGCCTTATGTACCTGTGGAGTTTGCTGACTTCAGTGTTTAC
AATGCCAGCTTGGAGAACAGGGAATGGTTTTCCTCTAAAGTAGATCTGTCAAACTCACGG
GTCTTGGAGAAAGAAGTGTCCCGTAGCCCTACCACCAGCAGTATTACCAGTGGCTACTTT
TCCCACAGTGCCTCCAATGCCACCCTGTCTGACATGGTGGTCCCTTCTAGTGACAGCTCA
GACCAGCTGGCCATTCAGACGAAGGATGCAGACTCCACCGAGCACTCCACACCATCGCTT
GTGCATGATTTCAGGCCGTCCTCAAACAAAGAGTTGACAGAAGTCGAAAAAGGCTTGGTA
AAGGACAAGATAATTGTGGTGCCACTCAAGGAAAACAGTGCCTTAGCCAAAGGGAGCCCA
TCATCCCAGAGCATCCCTGAGAAAAACTCCAAATCACTGTGCAGGACTGGCTCATGTTCA
GAACTAGATGCCTGCCCCAGCAAAATTAGCCAGCCAGCCAGGGGATTCTGCCCCAGGGAG
GTGACGGTAGAACACACCACCAACATCCTTGAAGACCATTCTTTCACAGAATTTATGGGA
GTGTCAGAGGGAAAAGATTTTGATGGTTTGACAGATTCTTCTGCTGGAGAGCTTTCCAGT
AGGAGGAGTCTACCAAATAAAACAGGCGGCAAGACTGTCTCCGATGGGCTCCACCACCCC
AGCCAGCTGCATTCCAAGTTAGAGAATGACCAGGTAATAATTCCAGAGGCAGCCTTTTGG
GTTCTGTGCTGTCAATGA
Protein Properties
Number of Residues 1805
Molecular Weight 202306.8
Theoretical pI 5.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Kinesin-like protein KIF13A
MSDTKVKVAVRVRPMNRRELELNTKCVVEMEGNQTVLHPPPSNTKQGERKPPKVFAFDYC
FWSMDESNTTKYAGQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKSFSMMGHAEQLG
LIPRLCCALFKRISLEQNESQTFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVLGP
YVDGLSQLAVTSFEDIESLMSEGNKSRTVAATNMNEESSRSHAVFNIIITQTLYDLQSGN
SGEKVSKVSLVDLAGSERVSKTGAAGERLKEGSNINKSLTTLGLVISSLADQAAGKGKSK
FVPYRDSVLTWLLKDNLGGNSQTSMIATISPAADNYEETLSTLRYADRAKRIVNHAVVNE
DPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEEI
AQERQRQLESMGISLEMSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDI
QLFGIGIQPQHCEIDIASDGDVTLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFR
INLPKRKRRDWLKDFEKETGPPEHDLDAASEASSEPDYNYEFAQMEVIMKTLNSNDPVQN
VVQVLEKQYLEEKRSALEEQRLMYERELEQLRQQLSPDRQPQSSGPDRLAYSSQTAQQKV
TQWAEERDELFRQSLAKLREQLVKANTLVREANFLAEEMSKLTDYQVTLQIPAANLSANR
KRGAIVSEPAIQVRRKGKSTQVWTIEKLENKLIDMRDLYQEWKEKVPEAKRLYGKRGDPF
YEAQENHNLIGVANVFLECLFCDVKLQYAVPIISQQGEVAGRLHVEVMRVTGAVPERVVE
DDSSENSSESGSLEVVDSSGEIIHRVKKLTCRVKIKEATGLPLNLSNFVFCQYTFWDQCE
STVAAPVVDPEVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAG
NGSSIWEVDSLHAKTRTLHDRWNEVTRRIEMWISILELNELGEYAAVELHQAKDVNTGGI
FQLRQGHSRRVQVTVKPVQHSGTLPLMVEAILSVSIGCVTARSTKLQRGLDSYQRDDEDG
DDMDSYQEEDLNCVRERWSDALIKRREYLDEQIKKVSNKTEKTEDDVEREAQLVEQWVGL
TEERNAVLVPAPGSGIPGAPADWIPPPGMETHIPVLFLDLNADDLSANEQLVGPHASGVN
SILPKEHGSQFFYLPIIKHSDDEVSATASWDSSVHDSVHLNRVTPQNERIYLIVKTTVQL
SHPAAMELVLRKRIAANIYNKQSFTQSLKRRISLKNIFYSCGVTYEIVSNIPKATEEIED
RETLALLAARSENEGTSDGETYIEKYTRGVLQVENILSLERLRQAVTVKEALSTKARHIR
RSLSTPNVHNVSSSRPDLSGFDEDDKGWPENQLDMSDYSSSYQDVACYGTLPRDSPRRNK
EGCTSETPHALTVSPFKAFSPQPPKFFKPLMPVKEEHKKRIALEARPLLSQESMPPPQAH
NPGCIVPSGSNGSSMPVEHNSKREKKIDSEEEENELEAINRKLISSQPYVPVEFADFSVY
NASLENREWFSSKVDLSNSRVLEKEVSRSPTTSSITSGYFSHSASNATLSDMVVPSSDSS
DQLAIQTKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIVVPLKENSALAKGSP
SSQSIPEKNSKSLCRTGSCSELDACPSKISQPARGFCPREVTVEHTTNILEDHSFTEFMG
VSEGKDFDGLTDSSAGELSSRRSLPNKTGGKTVSDGLHHPSQLHSKLENDQVIIPEAAFW
VLCCQ
GenBank ID Protein 157738621
UniProtKB/Swiss-Prot ID Q9H1H9
UniProtKB/Swiss-Prot Entry Name KI13A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022113.4
GeneCard ID KIF13A
GenAtlas ID KIF13A
HGNC ID HGNC:14566
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  5. Jamain S, Quach H, Fellous M, Bourgeron T: Identification of the human KIF13A gene homologous to Drosophila kinesin-73 and candidate for schizophrenia. Genomics. 2001 May 15;74(1):36-44. [PubMed:11374900 ]
  6. Chen D, Pajovic S, Duckett A, Brown VD, Squire JA, Gallie BL: Genomic amplification in retinoblastoma narrowed to 0.6 megabase on chromosome 6p containing a kinesin-like gene, RBKIN. Cancer Res. 2002 Feb 15;62(4):967-71. [PubMed:11861365 ]