You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10755
Secondary Accession Numbers
  • 17022
Name WD repeat domain phosphoinositide-interacting protein 1
Synonyms
  1. Atg18 protein homolog
  2. WD40 repeat protein interacting with phosphoinositides of 49 kDa
  3. WIPI 49 kDa
  4. WIPI-1
Gene Name WIPI1
Protein Type Unknown
Biological Properties
General Function Involved in androgen receptor binding
Specific Function May play a role in autophagy. May regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasmic vesicle
  2. Golgi apparatus
  3. Endosome
  4. trans-Golgi network
  5. clathrin-coated vesicle
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24.2
SNPs WIPI1
Gene Sequence
>1341 bp
ATGGAGGCCGAGGCCGCGGACGCTCCCCCGGGCGGGGTTGAGTCGGCGCTCAGCTGCTTC
TCTTTCAACCAGGACTGCACATCCCTAGCAACTGGAACTAAAGCCGGGTATAAGCTGTTT
TCTCTGAGTTCTGTGGAGCAGCTGGATCAAGTCCACGGAAGCAATGAAATCCCGGACGTC
TACATCGTGGAGCGCCTCTTCTCCAGCAGCCTGGTGGTGGTAGTCAGTCACACAAAACCA
CGGCAGATGAACGTGTATCACTTCAAGAAAGGCACAGAGATCTGTAATTACAGCTACTCC
AGCAACATCTTGTCCATAAGGCTGAACCGGCAAAGGCTGCTGGTTTGCCTAGAAGAGTCC
ATTTATATTCACAACATTAAAGACATGAAGCTGTTGAAGACCCTCCTGGATATTCCTGCA
AACCCAACAGGTCTATGTGCTCTCTCTATCAACCATTCCAATTCTTACCTGGCCTATCCT
GGAAGCCTGACTTCAGGGGAGATTGTGCTTTATGATGGAAACTCCCTGAAAACAGTCTGC
ACTATTGCTGCCCATGAGGGAACACTAGCTGCCATCACCTTCAATGCCTCAGGCTCCAAA
CTAGCAAGTGCGTCTGAAAAAGGCACAGTCATCCGGGTGTTCTCTGTCCCTGATGGGCAA
AAGCTCTATGAGTTCCGGAGAGGGATGAAAAGGTATGTGACAATCAGCTCTCTAGTGTTC
AGTATGGATTCACAATTCCTCTGCGCCTCCAGTAACACCGAGACGGTACACATCTTCAAG
CTGGAACAGGTCACCAACAGTCGACCAGAAGAGCCTTCGACCTGGAGTGGCTACATGGGA
AAGATGTTTATGGCTGCTACCAACTACCTCCCTACCCAGGTGTCAGACATGATGCATCAG
GACAGGGCTTTTGCCACTGCACGCTTGAACTTCTCCGGACAGAGGAACATCTGTACCCTC
TCAACGATCCAGAAGTTGCCACGGCTGCTAGTTGCGTCATCCAGTGGACACCTTTATATG
TACAATTTGGATCCTCAGGATGGAGGAGAGTGTGTCTTAATCAAAACCCACAGCTTGCTT
GGCTCAGGAACAACAGAAGAGAATAAAGAAAATGACCTCAGACCTTCCTTACCTCAGTCT
TATGCAGCGACCGTAGCCAGACCAAGTGCATCTTCAGCCTCCACGGTGCCAGGTTATTCT
GAGGACGGCGGGGCGCTGCGAGGAGAAGTTATTCCTGAACATGAGTTTGCGACGGGACCA
GTGTGTCTTGATGATGAGAATGAGTTTCCTCCTATAATCTTGTGCCGTGGAAATCAGAAG
GGCAAAACGAAGCAGTCATGA
Protein Properties
Number of Residues 446
Molecular Weight 48672.6
Theoretical pI 6.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>WD repeat domain phosphoinositide-interacting protein 1
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS
GenBank ID Protein 157388939
UniProtKB/Swiss-Prot ID Q5MNZ9
UniProtKB/Swiss-Prot Entry Name WIPI1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017983.5
GeneCard ID WIPI1
GenAtlas ID WIPI1
HGNC ID HGNC:25471
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Proikas-Cezanne T, Waddell S, Gaugel A, Frickey T, Lupas A, Nordheim A: WIPI-1alpha (WIPI49), a member of the novel 7-bladed WIPI protein family, is aberrantly expressed in human cancer and is linked to starvation-induced autophagy. Oncogene. 2004 Dec 16;23(58):9314-25. [PubMed:15602573 ]
  5. Jeffries TR, Dove SK, Michell RH, Parker PJ: PtdIns-specific MPR pathway association of a novel WD40 repeat protein, WIPI49. Mol Biol Cell. 2004 Jun;15(6):2652-63. Epub 2004 Mar 12. [PubMed:15020712 ]