Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10760
Secondary Accession Numbers
  • 17027
Name Eukaryotic translation initiation factor 5B
Synonyms
  1. Translation initiation factor IF-2
  2. eIF-5B
Gene Name EIF5B
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 2q11.2
SNPs EIF5B
Gene Sequence
>3663 bp
ATGGGGAAGAAACAGAAAAACAAGAGCGAAGACAGCACCAAGGATGACATTGATCTTGAT
GCCTTGGCTGCAGAAATAGAAGGAGCTGGTGCTGCCAAAGAACAGGAGCCTCAAAAGTCA
AAAGGGAAAAAGAAAAAAGAGAAAAAAAAGCAGGACTTTGATGAAGATGATATCCTGAAA
GAACTGGAAGAATTGTCTTTGGAAGCTCAAGGCATCAAAGCTGACAGAGAAACTGTTGCA
GTGAAGCCAACAGAAAACAATGAAGAGGAATTCACCTCAAAAGATAAAAAAAAGAAAGGA
CAGAAGGGCAAAAAACAGAGTTTTGATGATAATGATAGCGAAGAATTGGAAGATAAAGAT
TCAAAATCAAAAAAGACTGCAAAACCGAAAGTGGAAATGTACTCTGGGAGTGATGATGAT
GATGATTTTAACAAACTTCCTAAAAAAGCTAAAGGGAAAGCTCAAAAATCAAATAAGAAG
TGGGATGGGTCAGAGGAGGATGAGGATAACAGTAAAAAAATTAAAGAGCGTTCAAGAATA
AATTCTTCTGGTGAAAGTGGTGATGAATCAGATGAATTTTTGCAATCTAGAAAAGGACAG
AAAAAAAATCAGAAAAACAAGCCAGGTCCTAACATAGAAAGTGGGAATGAAGATGATGAC
GCCTCCTTCAAAATTAAGACAGTGGCCCAAAAGAAGGCAGAAAAGAAGGAGCGCGAGAGA
AAAAAGCGAGATGAAGAAAAAGCGAAACTGCGGAAGCTGAAAGAAAAAGAAGAGTTAGAA
ACAGGTAAAAAGGATCAGAGTAAACAAAAGGAATCTCAAAGGAAATTTGAAGAAGAAACT
GTAAAATCCAAAGTGACTGTTGATACTGGAGTAATTCCTGCCTCTGAAGAGAAAGCAGAG
ACTCCCACAGCTGCAGAAGATGACAATGAAGGAGACAAAAAGAAGAAAGATAAGAAGAAA
AAGAAAGGAGAAAAGGAAGAAAAAGAGAAAGAGAAGAAAAAAGGACCTAGCAAAGCCACT
GTTAAAGCTATGCAAGAAGCTCTGGCTAAGCTTAAAGAGGAAGAAGAAAGACAGAAGAGA
GAAGAGGAAGAACGTATAAAACGGCTTGAAGAATTAGAAGCCAAGCGTAAAGAAGAGGAA
CGATTGGAACAAGAAAAAAGAGAAAGGAAAAAGCAAAAAGAAAAAGAAAGAAAAGAACGC
TTGAAAAAAGAAGGGAAACTTTTAACTAAATCCCAGAGAGAAGCCAGAGCCAGAGCCGAA
GCTACTCTTAAACTGCTACAAGCTCAGGGTGTTGAAGTGCCATCAAAAGACTCTTTGCCA
AAGAAGAGGCCAATTTATGAAGATAAAAAGAGGAAAAAAATACCACAGCAGCTAGAAAGT
AAAGAAGTGTCTGAATCAATGGAATTATGTGCTGCTGTAGAAGTTATGGAACAAGGAGTA
CCAGAAAAGGAAGAGACACCACCTCCTGTTGAACCAGAAGAAGAAGAAGATACTGAGGAT
GCTGGATTGGATGATTGGGAAGCTATGGCCAGTGATGAGGAGACAGAAAAAGTAGAAGGA
AACAAAGTTCATATAGAAGTAAAAGAAAACCCTGAAGAGGAGGAGGAGGAGGAAGAAGAG
GAAGAAGAAGATGAAGAAAGTGAAGAAGAGGAGGAAGAGGAGGGAGAAAGTGAAGGCAGT
GAAGGTGATGAGGAAGATGAAAAGGTGTCAGATGAGAAGGATTCAGGGAAGACATTAGAT
AAAAAGCCAAGTAAAGAAATGAGCTCAGATTCTGAATATGACTCTGATGATGATCGGACT
AAAGAAGAAAGGGCTTATGACAAAGCAAAACGGAGGATTGAGAAACGGCGACTTGAACAT
AGTAAAAATGTAAACACCGAAAAGCTAAGAGCCCCTATTATCTGCGTACTTGGGCATGTG
GACACAGGGAAGACAAAAATTCTAGATAAGCTCCGTCACACACATGTACAAGATGGTGAA
GCAGGTGGTATCACACAACAAATTGGGGCCACCAATGTTCCTCTTGAAGCTATTAATGAA
CAGACTAAGATGATTAAAAATTTTGATAGAGAGAATGTACGGATTCCAGGAATGCTAATT
ATTGATACTCCTGGGCATGAATCTTTCAGTAATCTGAGAAATAGAGGAAGCTCTCTTTGT
GACATTGCCATTTTAGTTGTTGATATTATGCATGGTTTGGAGCCCCAGACAATTGAGTCT
ATCAACCTTCTCAAATCTAAAAAATGTCCCTTCATTGTTGCACTCAATAAGATTGATAGG
TTATATGATTGGAAAAAGAGTCCTGACTCTGATGTGGCTGCTACTTTAAAGAAGCAGAAA
AAGAATACAAAAGATGAATTTGAGGAGCGAGCAAAGGCTATTATTGTAGAATTTGCACAG
CAGGGTTTGAATGCTGCTTTGTTTTATGAGAATAAAGATCCCCGCACTTTTGTGTCTTTG
GTACCTACCTCTGCACATACTGGTGATGGCATGGGAAGTCTGATCTACCTTCTTGTAGAG
TTAACTCAGACCATGTTGAGCAAGAGACTTGCACACTGTGAAGAGCTGAGAGCACAGGTG
ATGGAGGTTAAAGCTCTCCCGGGGATGGGCACCACTATAGATGTCATCTTGATCAATGGG
CGTTTGAAGGAAGGAGATACAATCATTGTTCCTGGAGTAGAAGGGCCCATTGTAACTCAG
ATTCGAGGCCTCCTGTTACCTCCTCCTATGAAGGAATTACGAGTGAAGAACCAGTATGAA
AAGCATAAAGAAGTAGAAGCAGCTCAGGGGGTAAAGATTCTTGGAAAAGACCTGGAGAAA
ACATTGGCTGGTTTACCCCTCCTTGTGGCTTATAAAGAAGATGAAATCCCTGTTCTTAAA
GATGAATTGATCCATGAGTTAAAGCAGACACTAAATGCTATCAAATTAGAAGAAAAAGGA
GTCTATGTCCAGGCATCTACACTGGGTTCTTTGGAAGCTCTACTGGAATTTCTGAAAACA
TCAGAAGTGCCCTATGCAGGAATTAACATTGGCCCAGTGCATAAAAAAGATGTTATGAAG
GCTTCAGTGATGTTGGAACATGACCCTCAGTATGCAGTAATTTTGGCCTTCGATGTGAGA
ATTGAACGAGATGCACAAGAAATGGCTGATAGTTTAGGAGTTAGAATTTTTAGTGCAGAA
ATTATTTATCATTTATTTGATGCCTTTACAAAATATAGACAAGACTACAAGAAACAGAAA
CAAGAAGAATTTAAGCACATAGCAGTATTTCCCTGCAAGATAAAAATCCTCCCTCAGTAC
ATTTTTAATTCTCGAGATCCGATAGTGATGGGGGTGACGGTGGAAGCAGGTCAGGTGAAA
CAGGGGACACCCATGTGTGTCCCAAGCAAAAATTTTGTTGACATCGGAATAGTAACAAGT
ATTGAAATAAACCATAAACAAGTGGATGTTGCAAAAAAAGGACAAGAAGTTTGTGTAAAA
ATAGAACCTATCCCTGGTGAGTCACCCAAAATGTTTGGAAGACATTTTGAAGCTACAGAT
ATTCTTGTTAGTAAGATCAGCCGGCAGTCCATTGATGCACTCAAAGACTGGTTCAGAGAT
GAAATGCAGAAGAGTGACTGGCAGCTTATTGTGGAGCTGAAGAAAGTATTTGAAATCATC
TAA
Protein Properties
Number of Residues 1220
Molecular Weight 138825.9
Theoretical pI 5.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic translation initiation factor 5B
MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSLEAQGIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKD
SKSKKTAKPKVEMYSGSDDDDDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRI
NSSGESGDESDEFLQSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEETVKSKVTVDTGVIPASEEKAE
TPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGV
PEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEE
EEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRT
KEERAYDKAKRRIEKRRLEHSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGE
AGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQK
KNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII
GenBank ID Protein 84043963
UniProtKB/Swiss-Prot ID O60841
UniProtKB/Swiss-Prot Entry Name IF2P_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015904.3
GeneCard ID EIF5B
GenAtlas ID EIF5B
HGNC ID HGNC:30793
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  10. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  11. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  12. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  13. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  14. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  15. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921 ]
  16. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  17. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  18. Kim JE, Tannenbaum SR, White FM: Global phosphoproteome of HT-29 human colon adenocarcinoma cells. J Proteome Res. 2005 Jul-Aug;4(4):1339-46. [PubMed:16083285 ]
  19. Gevaert K, Staes A, Van Damme J, De Groot S, Hugelier K, Demol H, Martens L, Goethals M, Vandekerckhove J: Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC. Proteomics. 2005 Sep;5(14):3589-99. [PubMed:16097034 ]
  20. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  21. Stanchi F, Bertocco E, Toppo S, Dioguardi R, Simionati B, Cannata N, Zimbello R, Lanfranchi G, Valle G: Characterization of 16 novel human genes showing high similarity to yeast sequences. Yeast. 2001 Jan 15;18(1):69-80. [PubMed:11124703 ]
  22. Wilson SA, Sieiro-Vazquez C, Edwards NJ, Iourin O, Byles ED, Kotsopoulou E, Adamson CS, Kingsman SM, Kingsman AJ, Martin-Rendon E: Cloning and characterization of hIF2, a human homologue of bacterial translation initiation factor 2, and its interaction with HIV-1 matrix. Biochem J. 1999 Aug 15;342 ( Pt 1):97-103. [PubMed:10432305 ]
  23. Lee JH, Choi SK, Roll-Mecak A, Burley SK, Dever TE: Universal conservation in translation initiation revealed by human and archaeal homologs of bacterial translation initiation factor IF2. Proc Natl Acad Sci U S A. 1999 Apr 13;96(8):4342-7. [PubMed:10200264 ]