Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10761
Secondary Accession Numbers
  • 17028
Name Mitochondrial carnitine/acylcarnitine carrier protein CACL
Synonyms
  1. CACT-like
  2. Solute carrier family 25 member 29
Gene Name SLC25A29
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Has palmitoylcarnitine transporting activity (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to membrane
mitochondrial inner membrane
Component
membrane
cell part
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Molecular Function
acyl carnitine transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 14
Locus 14q32.2
SNPs SLC25A29
Gene Sequence
>912 bp
ATGGCGCTGGACTTCTTGGCTGGATGCGCGGGGGGTGTGGCAGGCGTGCTTGTGGGACAC
CCGTTTGACACGGTCAAGGTACGGCTTCAGGTCCAGAGCGTGGAGAAGCCTCAGTACCGC
GGGACGTTGCACTGCTTCAAGTCCATCATCAAGCAAGAGAGCGTGCTGGGCCTGTACAAG
GGCCTGGGCTCGCCGCTCATGGGGCTCACCTTCATCAACGCGCTGGTGTTCGGGGTGCAG
GGCAACACCCTCCGGGCCCTGGGCCACGACTCGCCCCTCAACCAGTTCCTGGCAGGTGCG
GCGGCGGGCGCCATCCAGTGCGTCATCTGCTGCCCCATGGAGCTGGCCAAGACGCGGCTG
CAGCTGCAGGACGCGGGCCCAGCGCGCACCTACAAGGGCTCGCTGGACTGCCTCGCGCAG
ATCTACGGGCACGAGGGTCTGCGTGGCGTCAACCGGGGCATGGTGTCCACGTTGCTGCGT
GAGACGCCCAGCTTCGGCGTCTACTTCCTCACCTATGACGCTCTCACGCGGGCGCTGGGC
TGCGAGCCGGGCGACCGCCTGCTGGTGCCCAAGCTGCTGTTGGCGGGCGGTACGTCAGGC
ATCGTGTCCTGGCTCTCTACCTATCCTGTGGACGTGGTCAAGTCGCGGCTGCAGGCGGAC
GGACTGCGGGGCGCCCCGCGCTACCGCGGCATCCTGGACTGCGTGCACCAGAGCTACCGC
GCCGAGGGCTGGCGCGTCTTCACACGGGGGCTGGCGTCCACGCTGCTGCGCGCCTTCCCC
GTCAACGCTGCCACCTTCGCCACCGTCACGGTGGTGCTCACCTACGCGCGCGGCGAGGAG
GCCGGGCCCGAGGGCGAGGCTGTGCCCGCCGCCCCTGCGGGGCCTGCCCTGGCGCAGCCC
TCCAGCCTGTGA
Protein Properties
Number of Residues 303
Molecular Weight 32061.87
Theoretical pI 8.755
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mitochondrial carnitine/acylcarnitine carrier protein CACL
MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGHDSPLNQFLAGAAAGAIQCVICCPMELAKTRL
QLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALG
CEPGDRLLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYR
AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPAAPAGPALAQP
SSL
GenBank ID Protein 86198310
UniProtKB/Swiss-Prot ID Q8N8R3
UniProtKB/Swiss-Prot Entry Name MCATL_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001039355.1
GeneCard ID SLC25A29
GenAtlas ID SLC25A29
HGNC ID HGNC:20116
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]