Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10763
Secondary Accession Numbers
  • 17031
Name ATP-binding cassette sub-family F member 1
Synonyms
  1. ATP-binding cassette 50
  2. TNF-alpha-stimulated ABC protein
Gene Name ABCF1
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function May function in mRNA translation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
atpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.33
SNPs ABCF1
Gene Sequence
>2538 bp
ATGCCGAAGGCGCCCAAGCAGCAGCCGCCGGAGCCCGAGTGGATCGGGGACGGAGAGAGC
ACGAGCCCATCAGACAAAGTGGTGAAGAAAGGGAAGAAGGACAAGAAGATCAAAAAAACG
TTCTTTGAAGAGCTGGCAGTAGAAGATAAACAGGCTGGGGAAGAAGAGAAAGTGCTCAAG
GAGAAGGAGCAGCAGCAGCAGCAACAGCAACAGCAGCAAAAAAAAAAGCGAGATACCCGA
AAAGGCAGGCGGAAGAAGGATGTGGATGATGATGGAGAAGAGAAAGAGCTCATGGAGCGT
CTTAAGAAGCTCTCAGTGCCAACCAGTGATGAGGAGGATGAAGTACCCGCCCCAAAACCC
CGCGGAGGGAAGAAAACCAAGGGTGGTAATGTTTTTGCAGCCCTGATTCAGGATCAGAGT
GAGGAAGAGGAGGAGGAAGAAAAACATCCTCCTAAGCCTGCCAAGCCGGAGAAGAATCGG
ATCAATAAGGCCGTATCTGAGGAACAGCAGCCTGCACTCAAGGGCAAAAAGGGAAAGGAA
GAGAAGTCAAAAGGGAAGGCTAAGCCTCAAAATAAATTCGCTGCTCTGGACAATGAAGAG
GAGGATAAAGAAGAAGAAATTATAAAGGAAAAGGAGCCTCCCAAACAAGGGAAGGAGAAG
GCCAAGAAGGCAGAGCAGGGTTCAGAGGAAGAAGGAGAAGGGGAAGAAGAGGAGGAGGAA
GGAGGAGAGTCTAAGGCAGATGATCCCTATGCTCATCTTAGCAAAAAGGAGAAGAAAAAG
CTGAAAAAACAGATGGAGTATGAGCGCCAAGTGGCTTCATTAAAAGCAGCCAATGCAGCT
GAAAATGACTTCTCCGTGTCCCAGGCGGAGATGTCCTCCCGCCAAGCCATGTTAGAAAAT
GCATCTGACATCAAGCTGGAGAAGTTCAGCATCTCCGCTCATGGCAAGGAGCTGTTCGTC
AATGCAGACCTGTACATTGTAGCCGGCCGCCGCTACGGGCTGGTAGGACCCAATGGCAAG
GGCAAGACCACACTCCTCAAGCACATTGCCAACCGAGCCCTGAGCATCCCTCCCAACATT
GATGTGTTGCTGTGTGAGCAGGAGGTGGTAGCAGATGAGACACCAGCAGTCCAGGCTGTT
CTTCGAGCTGACACCAAGCGATTGAAGCTGCTGGAAGAGGAGCGGCGGCTTCAGGGACAG
CTGGAACAAGGGGATGACACAGCTGCTGAGAGGCTAGAGAAGGTGTATGAGGAATTGCGG
GCCACTGGGGCGGCAGCTGCAGAGGCCAAAGCACGGCGGATCCTGGCTGGCCTGGGCTTT
GACCCTGAAATGCAGAATCGACCCACACAGAAGTTCTCAGGGGGCTGGCGCATGCGTGTC
TCCCTGGCCAGGGCACTGTTCATGGAGCCCACACTGCTGATGCTGGATGAGCCCACCAAC
CACCTGGACCTCAACGCTGTCATCTGGCTTAATAACTACCTCCAGGGCTGGCGGAAGACC
TTGCTGATCGTCTCCCATGACCAGGGCTTCTTGGATGATGTCTGCACTGATATCATCCAC
CTCGATGCCCAGCGGCTCCACTACTATAGGGGCAATTACATGACCTTCAAAAAGATGTAC
CAGCAGAAGCAGAAAGAACTGCTGAAACAGTATGAGAAGCAAGAGAAAAAGCTGAAGGAG
CTGAAGGCAGGCGGGAAGTCCACCAAGCAGGCGGAAAAACAAACGAAGGAAGCCCTGACT
CGGAAGCAGCAGAAATGCCGACGGAAAAACCAAGATGAGGAATCCCAGGAGGCCCCTGAG
CTCCTGAAGCGCCCTAAGGAGTACACTGTGCGCTTCACTTTTCCAGACCCCCCACCACTC
AGCCCTCCAGTGCTGGGTCTGCATGGTGTGACATTCGGCTACCAGGGACAGAAACCACTC
TTTAAGAACTTGGATTTTGGCATCGACATGGATTCAAGGATTTGCATTGTGGGCCCTAAT
GGTGTGGGGAAGAGTACGCTACTCCTGCTGCTGACTGGCAAGCTGACACCGACCCATGGG
GAAATGAGAAAGAACCACCGGCTGAAAATTGGCTTCTTCAACCAGCAGTATGCAGAGCAG
CTGCGCATGGAGGAGACGCCCACTGAGTACCTGCAGCGGGGCTTCAACCTGCCCTACCAG
GATGCCCGCAAGTGCCTGGGCCGCTTCGGCCTGGAGAGTCACGCCCACACCATCCAGATC
TGCAAACTCTCTGGTGGTCAGAAGGCGCGAGTTGTGTTTGCTGAGCTGGCCTGTCGGGAA
CCTGATGTCCTCATCTTGGACGAGCCAACCAATAACCTGGACATAGAGTCTATTGATGCT
CTAGGGGAGGCCATCAATGAATACAAGGGTGCTGTGATCGTTGTCAGCCATGATGCCCGA
CTCATCACAGAAACCAATTGCCAGCTGTGGGTGGTGGAGGAGCAGAGTGTTAGCCAAATC
GATGGTGACTTTGAAGACTACAAGCGGGAGGTGTTGGAGGCCCTGGGTGAAGTCATGGTC
AGCCGGCCCCGAGAGTGA
Protein Properties
Number of Residues 845
Molecular Weight 95925.2
Theoretical pI 6.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ATP-binding cassette sub-family F member 1
MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLK
EKEQQQQQQQQQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKP
RGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKE
EKSKGKAKPQNKFAALDNEEEDKEEEIIKEKEPPKQGKEKAKKAEQGSEEEGEGEEEEEE
GGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAAENDFSVSQAEMSSRQAMLEN
ASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNI
DVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELR
ATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTN
HLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMY
QQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPE
LLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPN
GVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQ
DARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDA
LGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMV
SRPRE
GenBank ID Protein 69354671
UniProtKB/Swiss-Prot ID Q8NE71
UniProtKB/Swiss-Prot Entry Name ABCF1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001025091.1
GeneCard ID ABCF1
GenAtlas ID ABCF1
HGNC ID HGNC:70
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  8. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  11. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  12. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  13. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  14. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  15. Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265 ]
  16. Kim JE, Tannenbaum SR, White FM: Global phosphoproteome of HT-29 human colon adenocarcinoma cells. J Proteome Res. 2005 Jul-Aug;4(4):1339-46. [PubMed:16083285 ]
  17. Richard M, Drouin R, Beaulieu AD: ABC50, a novel human ATP-binding cassette protein found in tumor necrosis factor-alpha-stimulated synoviocytes. Genomics. 1998 Oct 15;53(2):137-45. [PubMed:9790762 ]