You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10764
Secondary Accession Numbers
  • 17032
Name Antigen peptide transporter 1
Synonyms
  1. APT1
  2. ATP-binding cassette sub-family B member 2
  3. PSF-1
  4. Peptide supply factor 1
  5. Peptide transporter PSF1
  6. Peptide transporter TAP1
  7. Peptide transporter involved in antigen processing 1
  8. Really interesting new gene 4 protein
Gene Name TAP1
Protein Type Transporter
Biological Properties
General Function Involved in ATP binding
Specific Function Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
active transmembrane transporter activity
primary active transmembrane transporter activity
p-p-bond-hydrolysis-driven transmembrane transporter activity
atpase activity, coupled to transmembrane movement of substances
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
peptide transporter activity
transmembrane transporter activity
atpase activity
transporter activity
substrate-specific transporter activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
peptide transport
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs TAP1
Gene Sequence
>2427 bp
ATGGCTGAGCTTCTCGCCAGCGCAGGATCAGCCTGTTCCTGGGACTTTCCGAGAGCCCCG
CCCTCGTTCCCTCCCCCAGCCGCCAGTAGGGGAGGACTCGGCGGTACCCGGAGCTTCAGG
CCCCACCGGGGCGCGGAGAGTCCCAGACCCGGCCGGGACCGGGACGGCGTCCGAGTGCCA
ATGGCTAGCTCTAGGTGTCCCGCTCCCCGCGGGTGCCGCTGCCTCCCCGGAGCTTCTCTC
GCATGGCTGGGGACAGTACTGCTACTTCTCGCCGACTGGGTGCTGCTCCGGACCGCGCTG
CCCCGCATATTCTCCCTGCTGGTGCCCACCGCGCTGCCACTGCTCCGGGTCTGGGCGGTG
GGCCTGAGCCGCTGGGCCGTGCTCTGGCTGGGGGCCTGCGGGGTCCTCAGGGCAACGGTT
GGCTCCAAGAGCGAAAACGCAGGTGCCCAGGGCTGGCTGGCTGCTTTGAAGCCATTAGCT
GCGGCACTGGGCTTGGCCCTGCCGGGACTTGCCTTGTTCCGAGAGCTGATCTCATGGGGA
GCCCCCGGGTCCGCGGATAGCACCAGGCTACTGCACTGGGGAAGTCACCCTACCGCCTTC
GTTGTCAGTTATGCAGCGGCACTGCCCGCAGCAGCCCTGTGGCACAAACTCGGGAGCCTC
TGGGTGCCCGGCGGTCAGGGCGGCTCTGGAAACCCTGTGCGTCGGCTTCTAGGCTGCCTG
GGCTCGGAGACGCGCCGCCTCTCGCTGTTCCTGGTCCTGGTGGTCCTCTCCTCTCTTGGG
GAGATGGCCATTCCATTCTTTACGGGCCGCCTCACTGACTGGATTCTACAAGATGGCTCA
GCCGATACCTTCACTCGAAACTTAACTCTCATGTCCATTCTCACCATAGCCAGTGCAGTG
CTGGAGTTCGTGGGTGACGGGATCTATAACAACACCATGGGCCACGTGCACAGCCACTTG
CAGGGAGAGGTGTTTGGGGCTGTCCTGCGCCAGGAGACGGAGTTTTTCCAACAGAACCAG
ACAGGTAACATCATGTCTCGGGTAACAGAGGACACGTCCACCCTGAGTGATTCTCTGAGT
GAGAATCTGAGCTTATTTCTGTGGTACCTGGTGCGAGGCCTATGTCTCTTGGGGATCATG
CTCTGGGGATCAGTGTCCCTCACCATGGTCACCCTGATCACCCTGCCTCTGCTTTTCCTT
CTGCCCAAGAAGGTGGGAAAATGGTACCAGTTGCTGGAAGTGCAGGTGCGGGAATCTCTG
GCAAAGTCCAGCCAGGTGGCCATTGAGGCTCTGTCGGCCATGCCTACAGTTCGAAGCTTT
GCCAACGAGGAGGGCGAAGCCCAGAAGTTTAGGGAAAAGCTGCAAGAAATAAAGACACTC
AACCAGAAGGAGGCTGTGGCCTATGCAGTCAACTCCTGGACCACTAGTATTTCAGGTATG
CTGCTGAAAGTGGGAATCCTCTACATTGGTGGGCAGCTGGTGACCAGTGGGGCTGTAAGC
AGTGGGAACCTTGTCACATTTGTTCTCTACCAGATGCAGTTCACCCAGGCTGTGGAGGTA
CTGCTCTCCATCTACCCCAGAGTACAGAAGGCTGTGGGCTCCTCAGAGAAAATATTTGAG
TACCTGGACCGCACCCCTCGCTGCCCACCCAGTGGTCTGTTGACTCCCTTACACTTGGAG
GGCCTTGTCCAGTTCCAAGATGTCTCCTTTGCCTACCCAAACCGCCCAGATGTCTTAGTG
CTACAGGGGCTGACATTCACCCTACGCCCTGGCGAGGTGACGGCGCTGGTGGGACCCAAT
GGGTCTGGGAAGAGCACAGTGGCTGCCCTGCTGCAGAATCTGTACCAGCCCACCGGGGGA
CAGCTGCTGTTGGATGGGAAGCCCCTTCCCCAATATGAGCACCGCTACCTGCACAGGCAG
GTGGCTGCAGTGGGACAAGAGCCACAGGTATTTGGAAGAAGTCTTCAAGAAAATATTGCC
TATGGCCTGACCCAGAAGCCAACTATGGAGGAAATCACAGCTGCTGCAGTAAAGTCTGGG
GCCCATAGTTTCATCTCTGGACTCCCTCAGGGCTATGACACAGAGGTAGACGAGGCTGGG
AGCCAGCTGTCAGGGGGTCAGCGACAGGCAGTGGCGTTGGCCCGAGCATTGATCCGGAAA
CCGTGTGTACTTATCCTGGATGATGCCACCAGTGCCCTGGATGCAAACAGCCAGTTACAG
GTGGAGCAGCTCCTGTACGAAAGCCCTGAGCGGTACTCCCGCTCAGTGCTTCTCATCACC
CAGCACCTCAGCCTGGTGGAGCAGGCTGACCACATCCTCTTTCTGGAAGGAGGCGCTATC
CGGGAGGGGGGAACCCACCAGCAGCTCATGGAGAAAAAGGGGTGCTACTGGGCCATGGTG
CAGGCTCCTGCAGATGCTCCAGAATGA
Protein Properties
Number of Residues 808
Molecular Weight 87216.9
Theoretical pI 8.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 76-96
  • 114-136
  • 153-173
  • 194-214
  • 247-267
  • 288-308
  • 359-379
  • 389-409
  • 479-499
  • 504-524
Protein Sequence
>Antigen peptide transporter 1
MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVP
MASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAV
GLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWG
APGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCL
GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV
LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLS
ENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL
AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGM
LLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFE
YLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN
GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIA
YGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRK
PCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAI
REGGTHQQLMEKKGCYWAMVQAPADAPE
GenBank ID Protein 36061
UniProtKB/Swiss-Prot ID Q03518
UniProtKB/Swiss-Prot Entry Name TAP1_HUMAN
PDB IDs
GenBank Gene ID X57522
GeneCard ID TAP1
GenAtlas ID TAP1
HGNC ID HGNC:43
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Beck S, Abdulla S, Alderton RP, Glynne RJ, Gut IG, Hosking LK, Jackson A, Kelly A, Newell WR, Sanseau P, Radley E, Thorpe KL, Trowsdale J: Evolutionary dynamics of non-coding sequences within the class II region of the human MHC. J Mol Biol. 1996 Jan 12;255(1):1-13. [PubMed:8568858 ]
  4. Begley GS, Horvath AR, Taylor JC, Higgins CF: Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome. Mol Immunol. 2005 Jan;42(1):137-41. [PubMed:15488952 ]
  5. Trowsdale J, Hanson I, Mockridge I, Beck S, Townsend A, Kelly A: Sequences encoded in the class II region of the MHC related to the 'ABC' superfamily of transporters. Nature. 1990 Dec 20-27;348(6303):741-4. [PubMed:2259383 ]
  6. Beck S, Kelly A, Radley E, Khurshid F, Alderton RP, Trowsdale J: DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing. J Mol Biol. 1992 Nov 20;228(2):433-41. [PubMed:1453454 ]
  7. Jackson DG, Capra JD: TAP1 alleles in insulin-dependent diabetes mellitus: a newly defined centromeric boundary of disease susceptibility. Proc Natl Acad Sci U S A. 1993 Dec 1;90(23):11079-83. [PubMed:8248212 ]
  8. Spies T, Bresnahan M, Bahram S, Arnold D, Blanck G, Mellins E, Pious D, DeMars R: A gene in the human major histocompatibility complex class II region controlling the class I antigen presentation pathway. Nature. 1990 Dec 20-27;348(6303):744-7. [PubMed:2259384 ]
  9. Szafer F, Oksenberg JR, Steinman L: New allelic polymorphisms in TAP genes. Immunogenetics. 1994;39(5):374. [PubMed:8168860 ]
  10. Bahram S, Arnold D, Bresnahan M, Strominger JL, Spies T: Two putative subunits of a peptide pump encoded in the human major histocompatibility complex class II region. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10094-8. [PubMed:1946428 ]
  11. Ahn K, Meyer TH, Uebel S, Sempe P, Djaballah H, Yang Y, Peterson PA, Fruh K, Tampe R: Molecular mechanism and species specificity of TAP inhibition by herpes simplex virus ICP47. EMBO J. 1996 Jul 1;15(13):3247-55. [PubMed:8670825 ]
  12. Nijenhuis M, Hammerling GJ: Multiple regions of the transporter associated with antigen processing (TAP) contribute to its peptide binding site. J Immunol. 1996 Dec 15;157(12):5467-77. [PubMed:8955196 ]
  13. Zeidler R, Eissner G, Meissner P, Uebel S, Tampe R, Lazis S, Hammerschmidt W: Downregulation of TAP1 in B lymphocytes by cellular and Epstein-Barr virus-encoded interleukin-10. Blood. 1997 Sep 15;90(6):2390-7. [PubMed:9310490 ]
  14. Ahn K, Gruhler A, Galocha B, Jones TR, Wiertz EJ, Ploegh HL, Peterson PA, Yang Y, Fruh K: The ER-luminal domain of the HCMV glycoprotein US6 inhibits peptide translocation by TAP. Immunity. 1997 May;6(5):613-21. [PubMed:9175839 ]
  15. Furukawa H, Murata S, Yabe T, Shimbara N, Keicho N, Kashiwase K, Watanabe K, Ishikawa Y, Akaza T, Tadokoro K, Tohma S, Inoue T, Tokunaga K, Yamamoto K, Tanaka K, Juji T: Splice acceptor site mutation of the transporter associated with antigen processing-1 gene in human bare lymphocyte syndrome. J Clin Invest. 1999 Mar;103(5):755-8. [PubMed:10074494 ]
  16. Bennett EM, Bennink JR, Yewdell JW, Brodsky FM: Cutting edge: adenovirus E19 has two mechanisms for affecting class I MHC expression. J Immunol. 1999 May 1;162(9):5049-52. [PubMed:10227971 ]
  17. Hewitt EW, Gupta SS, Lehner PJ: The human cytomegalovirus gene product US6 inhibits ATP binding by TAP. EMBO J. 2001 Feb 1;20(3):387-96. [PubMed:11157746 ]
  18. Horst D, van Leeuwen D, Croft NP, Garstka MA, Hislop AD, Kremmer E, Rickinson AB, Wiertz EJ, Ressing ME: Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J Immunol. 2009 Feb 15;182(4):2313-24. doi: 10.4049/jimmunol.0803218. [PubMed:19201886 ]
  19. Gaudet R, Wiley DC: Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing. EMBO J. 2001 Sep 3;20(17):4964-72. [PubMed:11532960 ]
  20. Colonna M, Bresnahan M, Bahram S, Strominger JL, Spies T: Allelic variants of the human putative peptide transporter involved in antigen processing. Proc Natl Acad Sci U S A. 1992 May 1;89(9):3932-6. [PubMed:1570316 ]
  21. Chen HL, Gabrilovich D, Tampe R, Girgis KR, Nadaf S, Carbone DP: A functionally defective allele of TAP1 results in loss of MHC class I antigen presentation in a human lung cancer. Nat Genet. 1996 Jun;13(2):210-3. [PubMed:8640228 ]
  22. Tang J, Freedman DO, Allen S, Karita E, Musonda R, Braga C, Margolick J, Kaslow RA: TAPI polymorphisms in several human ethnic groups: characteristics, evolution, and genotyping strategies. Hum Immunol. 2001 Mar;62(3):256-68. [PubMed:11250043 ]
  23. Lajoie J, Zijenah LS, Faucher MC, Ward BJ, Roger M: Novel TAP1 polymorphisms in indigenous Zimbabweans: their potential implications on TAP function and in human diseases. Hum Immunol. 2003 Aug;64(8):823-9. [PubMed:12878362 ]