Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10766
Secondary Accession Numbers
  • 17034
Name Kinesin-like protein KIFC1
Synonyms
  1. Kinesin-like protein 2
  2. Kinesin-related protein HSET
Gene Name KIFC1
Protein Type Unknown
Biological Properties
General Function Involved in microtubule motor activity
Specific Function Minus end-directed microtubule-dependent motor required for bipolar spindle formation. May contribute to movement of early endocytic vesicles
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
hydrolase activity
motor activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
microtubule motor activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
microtubule-based process
microtubule-based movement
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Cytoplasm
  4. cytoskeleton
  5. cytoskeleton
  6. spindle
  7. centrosome
  8. Early endosome
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs KIFC1
Gene Sequence
>2022 bp
ATGGATCCGCAGAGGTCCCCCCTATTGGAAGTAAAGGGGAACATAGAACTGAAGAGACCT
CTGATTAAGGCCCCTTCCCAGCTGCCTCTCTCAGGAAGCAGACTCAAGAGGAGGCCTGAC
CAGATGGAAGATGGCCTGGAGCCTGAGAAGAAACGGACAAGAGGCCTGGGTGCAACGACC
AAAATTACCACATCCCACCCAAGAGTTCCATCCCTCACTACAGTGCCACAGACACAAGGC
CAGACCACAGCTCAAAAAGTTTCCAAGAAGACAGGACCCCGGTGTTCCACAGCTATTGCC
ACAGGGTTGAAGAACCAGAAGCCAGTTCCTGCTGTTCCTGTCCAGAAGTCTGGCACATCA
GGTGTTCCTCCCATGGCAGGAGGGAAGAAACCCAGCAAACGTCCAGCCTGGGACTTAAAG
GGTCAGTTATGTGACCTAAATGCAGAACTAAAACGGTGCCGTGAGAGGACTCAAACGTTG
GACCAAGAGAACCAGCAGCTTCAGGACCAGCTCAGAGATGCCCAGCAGCAGGTCAAGGCC
CTGGGGACAGAGCGCACAACACTGGAGGGGCATTTAGCCAAGGTACAGGCCCAGGCTGAG
CAGGGCCAACAGGAGCTGAAGAACTTGCGTGCTTGTGTCCTGGAGCTGGAAGAGCGGCTG
AGCACGCAGGAGGGCTTGGTGCAAGAGCTTCAGAAAAAACAGGTGGAATTGCAGGAAGAA
CGGAGGGGACTGATGTCCCAACTAGAGGAGAAGGAGAGGAGGCTGCAGACATCAGAAGCA
GCCCTGTCAAGCAGCCAAGCAGAGGTGGCATCTCTGCGGCAGGAGACTGTGGCCCAGGCA
GCCTTACTGACTGAGCGGGAAGAACGTCTTCATGGGCTAGAAATGGAGCGCCGGCGACTG
CACAACCAGCTGCAGGAACTCAAGGGCAACATCCGTGTATTCTGCCGGGTCCGCCCTGTC
CTGCCGGGGGAGCCCACTCCACCCCCTGGCCTCCTCCTGTTTCCCTCTGGCCCTGGTGGG
CCCTCTGATCCTCCAACCCGCCTTAGCCTCTCCCGGTCTGACGAGCGGCGTGGGACCCTG
AGTGGGGCACCAGCTCCCCCAACTCGCCATGATTTTTCCTTTGACCGGGTATTCCCACCA
GGAAGTGGACAGGATGAAGTGTTTGAAGAGATTGCCATGCTTGTCCAGTCAGCCCTGGAT
GGCTATCCAGTATGCATCTTTGCCTATGGCCAGACAGGCAGTGGCAAGACCTTCACAATG
GAGGGTGGGCCTGGGGGAGACCCCCAGTTGGAGGGGCTGATCCCTCGGGCCCTGCGGCAC
CTCTTCTCTGTGGCTCAGGAGCTGAGTGGTCAGGGCTGGACCTACAGCTTTGTAGCAAGC
TACGTAGAGATCTACAATGAGACTGTCCGGGACCTGCTGGCCACTGGAACCCGGAAGGGT
CAAGGGGGCGAGTGTGAGATTCGCCGTGCAGGGCCAGGGAGTGAGGAGCTCACTGTCACC
AATGCTCGATATGTCCCTGTCTCCTGTGAGAAAGAAGTGGACGCCCTGCTTCATCTGGCC
CGCCAGAATCGGGCTGTGGCCCGCACAGCCCAGAATGAACGGTCATCACGCAGCCACAGT
GTATTCCAGCTACAGATTTCTGGGGAGCACTCCAGCCGAGGCCTGCAGTGTGGGGCCCCC
CTCAGTCTTGTGGACCTGGCCGGGAGTGAGCGACTTGACCCCGGCTTAGCCCTCGGCCCC
GGGGAGCGGGAACGCCTTCGGGAAACACAGGCCATTAACAGCAGCCTGTCCACGCTGGGG
CTGGTTATCATGGCCCTGAGCAACAAGGAGTCCCACGTGCCTTACCGGAACAGCAAACTG
ACCTACCTGCTGCAGAACTCTCTGGGTGGTAGTGCTAAGATGCTCATGTTTGTGAACATT
TCTCCACTGGAAGAGAACGTCTCCGAGTCCCTCAACTCTCTACGCTTTGCCTCCAAGGTG
AACCAGTGTGTTATTGGTACTGCTCAGGCCAACAGGAAGTGA
Protein Properties
Number of Residues 673
Molecular Weight 73747.1
Theoretical pI 9.35
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Kinesin-like protein KIFC1
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATT
KITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTS
GVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKA
LGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEE
RRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL
HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTL
SGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKG
QGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHS
VFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG
LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV
NQCVIGTAQANRK
GenBank ID Protein 167555110
UniProtKB/Swiss-Prot ID Q9BW19
UniProtKB/Swiss-Prot Entry Name KIFC1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002263.3
GeneCard ID KIFC1
GenAtlas ID KIFC1
HGNC ID HGNC:6389
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  5. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  6. Janitz K, Wild A, Beck S, Savasta S, Beluffi G, Ziegler A, Volz A: Genomic organization of the HSET locus and the possible association of HLA-linked genes with immotile cilia syndrome (ICS). Immunogenetics. 1999 Jul;49(7-8):644-52. [PubMed:10369922 ]
  7. Ando A, Kikuti YY, Kawata H, Okamoto N, Imai T, Eki T, Yokoyama K, Soeda E, Ikemura T, Abe K, et al.: Cloning of a new kinesin-related gene located at the centromeric end of the human MHC region. Immunogenetics. 1994;39(3):194-200. [PubMed:8276466 ]
  8. Zhu C, Zhao J, Bibikova M, Leverson JD, Bossy-Wetzel E, Fan JB, Abraham RT, Jiang W: Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference. Mol Biol Cell. 2005 Jul;16(7):3187-99. Epub 2005 Apr 20. [PubMed:15843429 ]