You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10767
Secondary Accession Numbers
  • 17035
Name Zinc finger protein 638
Synonyms
  1. CTCL-associated antigen se33-1
  2. Cutaneous T-cell lymphoma-associated antigen se33-1
  3. Nuclear protein 220
  4. Zinc finger matrin-like protein
Gene Name ZNF638
Protein Type Unknown
Biological Properties
General Function Involved in nucleotide binding
Specific Function Binds to cytidine clusters in double-stranded DNA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus speckle
Gene Properties
Chromosome Location Chromosome:2
Locus 2p13.1
SNPs ZNF638
Gene Sequence
>5937 bp
ATGTCGAGACCCAGGTTTAATCCTCGAGGAGACTTTCCACTTCAAAGGCCACGAGCACCT
AACCCTTCTGGGATGAGGCCTCCAGGACCATTTATGAGGCCTGGATCTATGGGTCTCCCA
AGATTTTACCCAGCAGGGAGAGCACGTGGAATTCCACACAGATTTGCTGGCCATGAATCT
TATCAGAACATGGGGCCACAGAGAATGAATGTTCAGGTAACTCAACACAGAACTGATCCA
AGATTGACCAAAGAAAAACTGGATTTTCATGAAGCACAACAGAAGAAGGGGAAGCCTCAT
GGTAGCCGGTGGGATGATGAGCCTCATATATCTGCATCAGTGGCAGTGAAACAGAGTTCT
GTAACACAGGTTACAGAGCAGAGTCCCAAAGTACAGAGCCGCTATACAAAAGAGAGTGCC
TCAAGTATCTTAGCAAGTTTTGGATTATCTAATGAAGACCTAGAAGAACTTAGTCGCTAT
CCTGATGAACAACTAACTCCTGAAAATATGCCATTAATTTTGAGGGATATAAGAATGCGA
AAAATGGGGCGCCGATTACCTAATTTACCTTCTCAGAGCAGAAATAAAGAAACACTTGGT
AGTGAAGCAGTTTCAAGTAATGTGATCGATTATGGGCATGCAAGCAAATATGGCTACACA
GAAGATCCACTTGAAGTACGTATTTATGATCCTGAAATTCCAACTGATGAGGTCGAGAAT
GAATTTCAGTCACAGCAGAACATTTCTGCATCTGTTCCCAATCCAAATGTGATATGTAAT
TCTATGTTTCCTGTTGAAGACGTATTTCGCCAAATGGACTTCCCCGGTGAGTCCTCCAAT
AATCGGTCCTTTTTCTCAGTTGAGAGTGGAACCAAGATGTCAGGCTTACACATTTCAGGA
GGACAGTCAGTCCTTGAACCCATAAAATCCGTCAACCAATCCATTAACCAAACAGTTAGC
CAGACAATGAGTCAATCTCTGATTCCTCCATCTATGAACCAGCAACCTTTTTCGTCGGAA
TTAATTTCATCTGTAAGCCAGCAAGAGCGGATCCCACATGAACCTGTGATTAATTCATCT
AACGTACATGTTGGATCAAGAGGAAGTAAAAAGAATTACCAGTCACAGGCTGACATTCCC
ATTCGGTCTCCCTTTGGTATTGTGAAAGCATCCTGGCTACCAAAGTTTTCACATGCTGAT
GCCCAGAAGATGAAGAGACTTCCAACTCCTTCTATGATGAATGATTATTATGCAGCATCT
CCAAGAATATTTCCACATTTGTGTTCTCTGTGTAACGTAGAATGTAGTCATTTGAAGGAT
TGGATTCAGCATCAAAATACATCTACTCATATTGAGAGCTGTCGACAGTTACGTCAACAG
TATCCTGATTGGAATCCTGAGATCCTCCCATCGAGAAGAAATGAGGGCAATAGAAAAGAA
AATGAAACTCCACGAAGACGTTCTCATTCCCCCAGTCCTAGGCGTTCTAGAAGATCAAGC
TCAAGTCACAGATTCCGTCGGTCTCGAAGCCCAATGCATTACATGTATAGGCCGAGAAGT
CGAAGTCCAAGAATTTGCCATCGTTTCATTTCTAGATACAGATCCAGATCCAGATCCCGT
TCACCATATCGAATTAGAAATCCATTTAGAGGTAGTCCAAAATGCTTTCGATCAGTTAGC
CCTGAGAGGATGTCAAGGAGATCAGTGAGATCATCAGATAGAAAAAAAGCATTAGAAGAT
GTAGTACAACGATCTGGGCATGGGACAGAATTTAATAAACAGAAGCATCTTGAAGCTGCT
GATAAGGGACATTCACCAGCACAAAAGCCTAAAACTAGCAGTGGAACAAAACCATCAGTT
AAACCTACAAGCGCTACAAAGAGTGATTCAAATCTAGGAGGACATTCTATTCGTTGTAAA
TCAAAGAATCTTGAAGATGACACTTTGTCAGAATGTAAACAGGTGTCTGATAAAGCTGTT
TCTCTCCAGCGAAAGCTTCGGAAAGAACAGTCATTGCATTATGGTTCGGTTCTTCTTATA
ACTGAATTACCAGAGGATGGTTGTACTGAAGAAGATGTGAGAAAATTATTTCAACCATTT
GGGAAAGTGAATGATGTCCTAATTGTTCCATATAGAAAAGAGGCTTACCTAGAAATGGAA
TTTAAAGAGGCAATTACTGCAATTATGAAGTACATTGAAACAACACCTCTTACGATAAAA
GGAAAAAGTGTGAAAATATGTGTTCCAGGAAAGAAAAAAGCACAGAACAAAGAGGTGAAG
AAAAAGACTTTAGAGTCAAAGAAAGTATCTGCATCTACCTTAAAAAGAGATGCAGATGCT
TCAAAAGCTGTTGAAATTGTTACTTCAACTTCTGCTGCCAAAACTGGACAAGCCAAGGCA
TCTGTAGCCAAAGTAAACAAATCTACAGGGAAATCAGCAAGTTCTGTAAAATCTGTGGTA
ACGGTAGCTGTTAAAGGTAATAAAGCTTCAATCAAAACAGCAAAATCTGGTGGAAAGAAG
TCTCTAGAAGCCAAAAAGACTGGGAATGTCAAAAACAAAGACTCTAACAAACCTGTGACT
ATACCAGAAAACTCTGAAATAAAGACCAGTATTGAAGTCAAAGCCACTGAAAACTGTGCT
AAAGAAGCTATTTCTGATGCTGCTTTGGAGGCCACAGAGAATGAACCACTTAACAAGGAA
ACAGAAGAAATGTGTGTGATGCTTGTCTCTAATTTGCCTAATAAAGGATATTCTGTAGAA
GAAGTTTATGACTTAGCAAAACCATTTGGTGGTTTAAAGGATATCTTGATTTTATCATCT
CATAAAAAGGCATATATAGAAATAAATAGAAAAGCTGCTGAGTCTATGGTAAAATTTTAT
ACCTGCTTCCCAGTATTGATGGATGGAAATCAACTCTCAATAAGTATGGCTCCTGAAAAC
ATGAATATAAAAGATGAGGAAGCTATATTTATAACCTTGGTAAAAGAAAATGACCCAGAG
GCAAACATAGATACAATTTATGATCGATTTGTACATCTTGATAATTTACCGGAAGATGGA
CTTCAGTGTGTACTTTGTGTTGGACTTCAGTTTGGAAAAGTGGATCACCATGTATTCATA
AGTAATAGAAACAAGGCAATTCTTCAGTTAGATAGTCCTGAATCTGCTCAGTCAATGTAT
AGCTTTCTGAAACAAAATCCACAAAATATTGGTGACCATATGTTGACCTGCTCATTATCT
CCAAAGATAGACTTACCAGAGGTGCAAATTGAGCATGACCCAGAATTAGAAAAAGAAAGC
CCTGGCTTGAAAAACAGTCCAATTGATGAAAGTGAGGTGCAAACAGCAACTGATAGTCCC
TCTGTTAAACCTAATGAGCTTGAAGAAGAAAGTACTCCCAGCATTCAAACAGAAACTTTG
GTACAGCAGGAAGAGCCTTGTGAGGAAGAAGCTGAAAAAGCAACATGTGATTCTGACTTT
GCTGTTGAAACTTTGGAGCTTGAAACTCAAGGAGAGGAGGTCAAAGAAGAAATTCCTCTT
GTAGCATCCGCTTCAGTCAGTATTGAACAATTCACTGAAAATGCCGAGGAGTGTGCTTTA
AATCAGCAGATGTTTAACAGTGACTTGGAGAAGAAAGGGGCAGAAATTATTAACCCTAAA
ACAGCATTGTTACCATCTGACAGTGTGTTTGCAGAAGAAAGGAACCTCAAAGGAATTCTA
GAAGAATCTCCATCTGAAGCAGAAGATTTCATTTCTGGAATTACACAGACTATGGTAGAA
GCTGTAGCTGAAGTAGAAAAAAATGAAACTGTTTCGGAAATATTGCCATCAACTTGTATT
GTGACGTTAGTACCAGGAATTCCCACTGGGGATGAGAAGACAGTGGACAAAAAGAATATT
TCTGAAAAAAAAGGTAACATGGATGAAAAGGAGGAGAAGGAATTTAATACTAAGGAAACC
AGAATGGATCTTCAAATAGGAACAGAGAAGGCTGAAAAGAATGAAGGTAGGATGGATGCA
GAAAAGGTGGAAAAGATGGCAGCAATGAAAGAAAAGCCTGCAGAAAACACTTTATTCAAG
GCATACCCAAATAAAGGAGTGGGTCAGGCTAATAAGCCTGATGAAACTAGTAAAACTAGT
ATTCTGGCTGTATCAGATGTATCTAGCAGTAAACCAAGCATCAAGGCTGTTATAGTCTCT
TCTCCTAAGGCAAAAGCTACAGTTTCAAAAACTGAAAATCAGAAAAGTTTTCCAAAATCT
GTGCCCAGAGATCAAATAAATGCTGAAAAGAAACTTTCAGCCAAGGAATTTGGTCTGCTT
AAACCCACAAGTGCCAGGTCAGGCTTGGCAGAAAGCAGCAGTAAATTCAAACCTACTCAG
AGCAGTCTTACCAGAGGAGGCAGTGGAAGGATCTCAGCCCTGCAAGGCAAGCTTTCTAAA
CTGGATTACAGAGATATAACAAAACAATCTCAGGAAACAGAGGCTAGACCTTCCATCATG
AAACGGGATGACAGCAACAATAAGACTTTGGCTGAGCAAAACACTAAGAATCCTAAAAGC
ACTACTGGTAGAAGTTCCAAATCTAAAGAGGAGCCATTATTTCCATTTAATTTGGATGAA
TTTGTTACTGTGGATGAGGTTATAGAAGAAGTGAATCCTTCTCAGGCCAAGCAGAATCCA
CTAAAGGGAAAAAGGAAAGAAACTCTCAAAAATGTTCCTTTCTCTGAACTTAACTTAAAG
AAGAAAAAGGGGAAAACTTCCACTCCTCGTGGTGTTGAGGGAGAACTATCTTTTGTGACA
TTGGATGAGATTGGGGAAGAGGAAGATGCAGCTGCACATCTAGCACAAGCTCTAGTCACT
GTGGATGAAGTAATTGATGAAGAAGAACTAAATATGGAAGAAATGGTAAAAAATTCAAAT
TCACTTTTTACATTAGATGAATTAATTGACCAAGATGATTGCATTTCCCACAGTGAACCT
AAAGATGTTACTGTTCTGTCAGTGGCTGAAGAACAAGATCTCCTCAAACAGGAACGCTTG
GTAACTGTGGATGAAATTGGAGAAGTGGAAGAGCTACCTTTGAATGAGTCAGCAGACATA
ACTTTTGCCACTTTAAATACTAAAGGAAATGAAGGAGATACTGTAAGGGATTCCATTGGC
TTCATTTCTTCTCAGGTGCCCGAAGACCCTTCTACTTTAGTTACTGTAGATGAAATACAA
GATGACAGCAGTGATTTGCATTTAGTGACTTTGGATGAAGTAACTGAAGAGGATGAAGAC
TCTCTGGCGGATTTTAACAACCTTAAAGAAGAGCTTAATTTTGTTACTGTTGATGAAGTT
GGAGAGGAGGAAGATGGAGATAATGATTTAAAAGTTGAGTTAGCACAAAGCAAAAATGAC
CATCCCACAGATAAAAAAGGGAATAGAAAGAAGAGAGCTGTGGACACAAAAAAGACAAAA
CTTGAATCCTTGTCCCAAGTGGGTCCAGTAAATGAGAATGTTATGGAAGAAGATCTAAAA
ACCATGATTGAAAGACACTTAACAGCTAAAACTCCAACCAAGAGAGTTAGAATTGGGAAA
ACTCTGCCATCAGAAAAAGCTGTTGTGACAGAACCAGCAAAAGGTGAAGAGGCCTTCCAG
ATGAGTGAAGTTGATGAGGAATCTGGATTAAAGGATTCAGAACCAGAGCGAAAACGCAAG
AAGACTGAAGACTCTTCTTCAGGCAAATCAGTGGCGTCTGATGTCCCTGAGGAATTAGAC
TTTCTTGTACCTAAGGCTGGATTCTTCTGTCCAATTTGTTCCCTCTTCTACTCAGGTGAA
AAAGCAATGACAAATCACTGCAAGAGTACACGTCATAAGCAAAATACTGAGAAATTCATG
GCCAAGCAAAGAAAGGAAAAGGAGCAGAATGAGGCTGAAGAAAGAAGCTCTAGGTGA
Protein Properties
Number of Residues 1978
Molecular Weight 220622.9
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 638
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFAGHES
YQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPHGSRWDDEPHISASVAVKQSS
VTQVTEQSPKVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRRLPNLPSQSRNKETLGSEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVEN
EFQSQQNISASVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSS
NVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAAS
PRIFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKE
NETPRRRSHSPSPRRSRRSSSSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSR
SPYRIRNPFRGSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLSECKQVSDKAV
SLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEME
FKEAITAIMKYIETTPLTIKGKSVKICVPGKKKAQNKEVKKKTLESKKVSASTLKRDADA
SKAVEIVTSTSAAKTGQAKASVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKK
SLEAKKTGNVKNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINRKAAESMVKFY
TCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPEANIDTIYDRFVHLDNLPEDG
LQCVLCVGLQFGKVDHHVFISNRNKAILQLDSPESAQSMYSFLKQNPQNIGDHMLTCSLS
PKIDLPEVQIEHDPELEKESPGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETL
VQQEEPCEEEAEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECAL
NQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDFISGITQTMVE
AVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNISEKKGNMDEKEEKEFNTKET
RMDLQIGTEKAEKNEGRMDAEKVEKMAAMKEKPAENTLFKAYPNKGVGQANKPDETSKTS
ILAVSDVSSSKPSIKAVIVSSPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLL
KPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIM
KRDDSNNKTLAEQNTKNPKSTTGRSSKSKEEPLFPFNLDEFVTVDEVIEEVNPSQAKQNP
LKGKRKETLKNVPFSELNLKKKKGKTSTPRGVEGELSFVTLDEIGEEEDAAAHLAQALVT
VDEVIDEEELNMEEMVKNSNSLFTLDELIDQDDCISHSEPKDVTVLSVAEEQDLLKQERL
VTVDEIGEVEELPLNESADITFATLNTKGNEGDTVRDSIGFISSQVPEDPSTLVTVDEIQ
DDSSDLHLVTLDEVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKND
HPTDKKGNRKKRAVDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAKTPTKRVRIGK
TLPSEKAVVTEPAKGEEAFQMSEVDEESGLKDSEPERKRKKTEDSSSGKSVASDVPEELD
FLVPKAGFFCPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR
GenBank ID Protein 62526045
UniProtKB/Swiss-Prot ID Q14966
UniProtKB/Swiss-Prot Entry Name ZN638_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001014972.1
GeneCard ID ZNF638
GenAtlas ID ZNF638
HGNC ID HGNC:17894
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  11. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  12. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  13. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  14. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  15. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  16. Eichmuller S, Usener D, Dummer R, Stein A, Thiel D, Schadendorf D: Serological detection of cutaneous T-cell lymphoma-associated antigens. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):629-34. Epub 2001 Jan 9. [PubMed:11149944 ]
  17. Inagaki H, Matsushima Y, Nakamura K, Ohshima M, Kadowaki T, Kitagawa Y: A large DNA-binding nuclear protein with RNA recognition motif and serine/arginine-rich domain. J Biol Chem. 1996 May 24;271(21):12525-31. [PubMed:8647861 ]
  18. Ng EK, Chan KK, Wong CH, Tsui SK, Ngai SM, Lee SM, Kotaka M, Lee CY, Waye MM, Fung KP: Interaction of the heart-specific LIM domain protein, FHL2, with DNA-binding nuclear protein, hNP220. J Cell Biochem. 2002;84(3):556-66. [PubMed:11813260 ]