Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10774
Secondary Accession Numbers
  • 17043
Name APOBEC1 complementation factor
Synonyms
  1. APOBEC1-stimulating protein
Gene Name A1CF
Protein Type Unknown
Biological Properties
General Function Involved in nucleotide binding
Specific Function Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
nucleic acid binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Endoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11.23
SNPs A1CF
Gene Sequence
>1785 bp
ATGGAAGCAGTGTGTCTGGGCACATGCCCAGAGCCAGAAGCGAGCATGAGCACAGCAATT
CCTGGCCTCAAAAAAGGAAATAATGCTTTGCAGTCCATCATTTTGCAAACTTTGCTGGAA
AAGGAAAATGGACAAAGAAAATATGGTGGCCCTCCACCTGGTTGGGATGCTGCACCCCCT
GAAAGGGGCTGTGAAATTTTTATTGGAAAACTTCCCCGAGACCTTTTTGAGGATGAGCTT
ATACCATTATGTGAAAAAATCGGTAAAATTTATGAAATGAGAATGATGATGGATTTTAAT
GGCAACAATAGAGGATATGCATTTGTAACATTTTCAAATAAAGTGGAAGCCAAGAATGCA
ATCAAGCAACTTAATAATTATGAAATTAGAAATGGGCGCCTCTTAGGGGTTTGTGCCAGT
GTGGACAACTGCCGATTATTTGTTGGGGGCATCCCAAAAACCAAAAAGAGAGAAGAAATC
TTATCGGAGATGAAAAAGGTTACTGAAGGTGTTGTCGATGTCATCGTCTACCCAAGCGCT
GCAGATAAAACCAAAAACCGAGGCTTTGCCTTCGTGGAGTATGAGAGTCATCGAGCAGCT
GCCATGGCGAGGAGGAAACTGCTACCAGGAAGAATTCAGTTATGGGGACATGGTATTGCA
GTAGACTGGGCAGAGCCAGAAGTAGAAGTTGATGAAGATACAATGTCTTCAGTGAAAATC
CTATATGTAAGAAATCTTATGCTGTCTACCTCTGAAGAGATGATTGAAAAGGAATTCAAC
AATATCAAACCAGGTGCTGTGGAGAGGGTGAAGAAAATTCGAGACTATGCTTTTGTGCAC
TTCAGTAACCGAGAAGATGCAGTTGAGGCTATGAAAGCTTTAAATGGCAAGGTGCTGGAT
GGTTCCCCCATTGAAGTCACCCTAGCAAAACCAGTGGACAAGGACAGTTATGTTAGGTAT
ACCCGAGGCACAGGTGGAAGGGGCACCATGCTGCAAGGAGAGTATACCTACTCTTTGGGC
CAAGTTTATGATCCCACCACAACCTACCTTGGAGCTCCTGTCTTCTATGCCCCCCAGACC
TATGCAGCAATTCCCAGTCTTCATTTCCCAGCCACCAAAGGACATCTCAGCAACAGAGCC
ATTATCCGAGCCCCTTCTGTTAGAGGGGCTGCGGGAGTGAGAGGACTGGGCGGCCGTGGC
TATTTGGCATACACAGGCCTGGGTCGAGGATACCAGGTCAAAGGAGACAAAAGAGAAGAC
AAACTCTATGACATTTTACCTGGGATGGAGCTCACCCCAATGAATCCTGTCACATTAAAA
CCCCAAGGAATTAAACTCGCTCCCCAGATATTAGAAGAGATTTGTCAGAAAAATAACTGG
GGACAGCCAGTGTACCAGCTGCACTCTGCTATTGGACAAGACCAAAGACAGCTATTCTTG
TACAAAATAACTATTCCTGCTCTAGCCAGCCAGAATCCTGCAATCCACCCTTTCACACCT
CCAAAGCTGAGTGCCTTTGTGGATGAAGCAAAGACGTATGCAGCCGAATACACCCTGCAG
ACCCTGGGCATCCCCACTGATGGAGGCGATGGCACCATGGCTACTGCTGCTGCTGCTGCT
ACTGCTTTCCCAGGATATGCTGTCCCTAATGCAACTGCACCCGTGTCTGCAGCCCAGCTC
AAGCAAGCGGTAACCCTTGGACAAGACTTAGCAGCATATACAACCTATGAGGTCTACCCA
ACTTTTGCAGTGACTGCCCGAGGGGATGGATATGGCACCTTCTGA
Protein Properties
Number of Residues 594
Molecular Weight 65202.0
Theoretical pI 8.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>APOBEC1 complementation factor
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLH
FPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFL
YKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAA
TAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
GenBank ID Protein 311771768
UniProtKB/Swiss-Prot ID Q9NQ94
UniProtKB/Swiss-Prot Entry Name A1CF_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001198820.1
GeneCard ID A1CF
GenAtlas ID A1CF
HGNC ID HGNC:24086
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  4. Lellek H, Kirsten R, Diehl I, Apostel F, Buck F, Greeve J: Purification and molecular cloning of a novel essential component of the apolipoprotein B mRNA editing enzyme-complex. J Biol Chem. 2000 Jun 30;275(26):19848-56. [PubMed:10781591 ]
  5. Mehta A, Kinter MT, Sherman NE, Driscoll DM: Molecular cloning of apobec-1 complementation factor, a novel RNA-binding protein involved in the editing of apolipoprotein B mRNA. Mol Cell Biol. 2000 Mar;20(5):1846-54. [PubMed:10669759 ]
  6. Blanc V, Navaratnam N, Henderson JO, Anant S, Kennedy S, Jarmuz A, Scott J, Davidson NO: Identification of GRY-RBP as an apolipoprotein B RNA-binding protein that interacts with both apobec-1 and apobec-1 complementation factor to modulate C to U editing. J Biol Chem. 2001 Mar 30;276(13):10272-83. Epub 2000 Dec 27. [PubMed:11134005 ]
  7. Henderson JO, Blanc V, Davidson NO: Isolation, characterization and developmental regulation of the human apobec-1 complementation factor (ACF) gene. Biochim Biophys Acta. 2001 Nov 11;1522(1):22-30. [PubMed:11718896 ]
  8. Mehta A, Driscoll DM: Identification of domains in apobec-1 complementation factor required for RNA binding and apolipoprotein-B mRNA editing. RNA. 2002 Jan;8(1):69-82. [PubMed:11871661 ]
  9. Chester A, Somasekaram A, Tzimina M, Jarmuz A, Gisbourne J, O'Keefe R, Scott J, Navaratnam N: The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay. EMBO J. 2003 Aug 1;22(15):3971-82. [PubMed:12881431 ]
  10. Blanc V, Kennedy S, Davidson NO: A novel nuclear localization signal in the auxiliary domain of apobec-1 complementation factor regulates nucleocytoplasmic import and shuttling. J Biol Chem. 2003 Oct 17;278(42):41198-204. Epub 2003 Aug 1. [PubMed:12896982 ]