Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10776
Secondary Accession Numbers
  • 17045
Name Uracil nucleotide/cysteinyl leukotriene receptor
Synonyms
  1. G-protein coupled receptor 17
  2. P2Y-like receptor
  3. R12
  4. UDP/CysLT receptor
Gene Name GPR17
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
nucleotide receptor activity, g-protein coupled
purinergic nucleotide receptor activity, g-protein coupled
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q21
SNPs GPR17
Gene Sequence
>1104 bp
ATGTCCAAACGGAGTTGGTGGGCTGGATCCAGAAAGCCCCCAAGAGAGATGCTGAAACTC
TCAGGCTCTGACTCCAGCCAAAGCATGAATGGCCTTGAAGTGGCTCCCCCAGGTCTGATC
ACCAACTTCTCCCTGGCCACGGCAGAGCAATGTGGCCAGGAGACGCCACTGGAGAACATG
CTGTTCGCCTCCTTCTACCTTCTGGATTTTATCCTGGCTTTAGTTGGCAATACCCTGGCT
CTGTGGCTTTTCATCCGAGACCACAAGTCCGGGACCCCGGCCAACGTGTTCCTGATGCAT
CTGGCCGTGGCCGACTTGTCGTGCGTGCTGGTCCTGCCCACCCGCCTGGTCTACCACTTC
TCTGGGAACCACTGGCCATTTGGGGAAATCGCATGCCGTCTCACCGGCTTCCTCTTCTAC
CTCAACATGTACGCCAGCATCTACTTCCTCACCTGCATCAGCGCCGACCGTTTCCTGGCC
ATTGTGCACCCGGTCAAGTCCCTCAAGCTCCGCAGGCCCCTCTACGCACACCTGGCCTGT
GCCTTCCTGTGGGTGGTGGTGGCTGTGGCCATGGCCCCGCTGCTGGTGAGCCCACAGACC
GTGCAGACCAACCACACGGTGGTCTGCCTGCAGCTGTACCGGGAGAAGGCCTCCCACCAT
GCCCTGGTGTCCCTGGCAGTGGCCTTCACCTTCCCGTTCATCACCACGGTCACCTGCTAC
CTGCTGATCATCCGCAGCCTGCGGCAGGGCCTGCGTGTGGAGAAGCGCCTCAAGACCAAG
GCAGTGCGCATGATCGCCATAGTGCTGGCCATCTTCCTGGTCTGCTTCGTGCCCTACCAC
GTCAACCGCTCCGTCTACGTGCTGCACTACCGCAGCCATGGGGCCTCCTGCGCCACCCAG
CGCATCCTGGCCCTGGCAAACCGCATCACCTCCTGCCTCACCAGCCTCAACGGGGCACTC
GACCCCATCATGTATTTCTTCGTGGCTGAGAAGTTCCGCCACGCCCTGTGCAACTTGCTC
TGTGGCAAAAGGCTCAAGGGCCCGCCCCCCAGCTTCGAAGGGAAAACCAACGAGAGCTCG
CTGAGTGCCAAGTCAGAGCTGTGA
Protein Properties
Number of Residues 367
Molecular Weight 40989.0
Theoretical pI 9.82
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 65-85
  • 93-113
  • 134-154
  • 176-196
  • 224-244
  • 261-281
  • 309-329
Protein Sequence
>Uracil nucleotide/cysteinyl leukotriene receptor
MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM
LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF
SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC
AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY
LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ
RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS
LSAKSEL
GenBank ID Protein 238814302
UniProtKB/Swiss-Prot ID Q13304
UniProtKB/Swiss-Prot Entry Name GPR17_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001161415.1
GeneCard ID GPR17
GenAtlas ID GPR17
HGNC ID HGNC:4471
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Raport CJ, Schweickart VL, Chantry D, Eddy RL Jr, Shows TB, Godiska R, Gray PW: New members of the chemokine receptor gene family. J Leukoc Biol. 1996 Jan;59(1):18-23. [PubMed:8558062 ]
  4. Blasius R, Weber RG, Lichter P, Ogilvie A: A novel orphan G protein-coupled receptor primarily expressed in the brain is localized on human chromosomal band 2q21. J Neurochem. 1998 Apr;70(4):1357-65. [PubMed:9523551 ]
  5. Ciana P, Fumagalli M, Trincavelli ML, Verderio C, Rosa P, Lecca D, Ferrario S, Parravicini C, Capra V, Gelosa P, Guerrini U, Belcredito S, Cimino M, Sironi L, Tremoli E, Rovati GE, Martini C, Abbracchio MP: The orphan receptor GPR17 identified as a new dual uracil nucleotides/cysteinyl-leukotrienes receptor. EMBO J. 2006 Oct 4;25(19):4615-27. Epub 2006 Sep 21. [PubMed:16990797 ]