You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10777
Secondary Accession Numbers
  • 17046
Name Oxoeicosanoid receptor 1
Synonyms
  1. 5-oxo-ETE G-protein coupled receptor
  2. G-protein coupled receptor 170
  3. G-protein coupled receptor R527
  4. G-protein coupled receptor TG1019
Gene Name OXER1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid. Seems to be coupled to the G(i)/G(o), families of heteromeric G proteins
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2p21
SNPs OXER1
Gene Sequence
>1272 bp
ATGTTGTGTCACCGTGGTGGCCAGCTGATAGTGCCAATCATCCCACTTTGCCCTGAGCAC
TCCTGCAGGGGTAGAAGACTCCAGAACCTTCTCTCAGGCCCATGGCCCAAGCAGCCCATG
GAACTTCATAACCTGAGCTCTCCATCTCCCTCTCTCTCCTCCTCTGTTCTCCCTCCCTCC
TTCTCTCCCTCACCCTCCTCTGCTCCCTCTGCCTTTACCACTGTGGGGGGGTCCTCTGGA
GGGCCCTGCCACCCCACCTCTTCCTCGCTGGTGTCTGCCTTCCTGGCACCAATCCTGGCC
CTGGAGTTTGTCCTGGGCCTGGTGGGGAACAGTTTGGCCCTCTTCATCTTCTGCATCCAC
ACGCGGCCCTGGACCTCCAACACGGTGTTCCTGGTCAGCCTGGTGGCCGCTGACTTCCTC
CTGATCAGCAACCTGCCCCTCCGCGTGGACTACTACCTCCTCCATGAGACCTGGCGCTTT
GGGGCTGCTGCCTGCAAAGTCAACCTCTTCATGCTGTCCACCAACCGCACGGCCAGCGTT
GTCTTCCTCACAGCCATCGCACTCAACCGCTACCTGAAGGTGGTGCAGCCCCACCACGTG
CTGAGCCGTGCTTCCGTGGGGGCAGCTGCCCGGGTGGCCGGGGGACTCTGGGTGGGCATC
CTGCTCCTCAACGGGCACCTGCTCCTGAGCACCTTCTCCGGCCCCTCCTGCCTCAGCTAC
AGGGTGGGCACGAAGCCCTCGGCCTCGCTCCGCTGGCACCAGGCACTGTACCTGCTGGAG
TTCTTCCTGCCACTGGCGCTCATCCTCTTTGCTATTGTGAGCATTGGGCTCACCATCCGG
AACCGTGGTCTGGGCGGGCAGGCAGGCCCGCAGAGGGCCATGCGTGTGCTGGCCATGGTG
GTGGCCGTCTACACCATCTGCTTCTTGCCCAGCATCATCTTTGGCATGGCTTCCATGGTG
GCTTTCTGGCTGTCCGCCTGCCGATCCCTGGACCTCTGCACACAGCTCTTCCATGGCTCC
CTGGCCTTCACCTACCTCAACAGTGTCCTGGACCCCGTGCTCTACTGCTTCTCTAGCCCC
AACTTCCTCCACCAGAGCCGGGCCTTGCTGGGCCTCACGCGGGGCCGGCAGGGCCCAGTG
AGCGACGAGAGCTCCTACCAACCCTCCAGGCAGTGGCGCTACCGGGAGGCCTCTAGGAAG
GCGGAGGCCATAGGGAAGCTGAAAGTGCAGGGCGAGGTCTCTCTGGAAAAGGAAGGCTCC
TCCCAGGGCTGA
Protein Properties
Number of Residues 423
Molecular Weight 45810.0
Theoretical pI 9.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 98-118
  • 127-147
  • 169-191
  • 212-232
  • 255-275
  • 296-316
  • 337-357
Protein Sequence
>Oxoeicosanoid receptor 1
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
GenBank ID Protein 22507376
UniProtKB/Swiss-Prot ID Q8TDS5
UniProtKB/Swiss-Prot Entry Name OXER1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_148962.4
GeneCard ID OXER1
GenAtlas ID OXER1
HGNC ID HGNC:24884
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Takeda S, Kadowaki S, Haga T, Takaesu H, Mitaku S: Identification of G protein-coupled receptor genes from the human genome sequence. FEBS Lett. 2002 Jun 5;520(1-3):97-101. [PubMed:12044878 ]
  4. Hosoi T, Koguchi Y, Sugikawa E, Chikada A, Ogawa K, Tsuda N, Suto N, Tsunoda S, Taniguchi T, Ohnuki T: Identification of a novel human eicosanoid receptor coupled to G(i/o). J Biol Chem. 2002 Aug 30;277(35):31459-65. Epub 2002 Jun 13. [PubMed:12065583 ]
  5. Jones CE, Holden S, Tenaillon L, Bhatia U, Seuwen K, Tranter P, Turner J, Kettle R, Bouhelal R, Charlton S, Nirmala NR, Jarai G, Finan P: Expression and characterization of a 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid receptor highly expressed on human eosinophils and neutrophils. Mol Pharmacol. 2003 Mar;63(3):471-7. [PubMed:12606753 ]