You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10784
Secondary Accession Numbers
  • 17055
Name Aquaporin-10
Synonyms
  1. AQP-10
  2. Aquaglyceroporin-10
  3. Small intestine aquaporin
Gene Name AQP10
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Water channel required to promote glycerol permeability and water transport across cell membranes. May contribute to water transport in the upper portion of small intestine. Isoform 2 is not permeable to urea and glycerol
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.3
SNPs AQP10
Gene Sequence
>906 bp
ATGGTCTTCACTCAGGCCCCGGCTGAAATCATGGGCCACCTCCGGATACGCAGCCTCCTG
GCCCGGCAGTGCCTGGCAGAGTTTCTGGGTGTGTTTGTACTCATGCTCCTCACCCAAGGA
GCTGTGGCCCAGGCTGTCACCAGTGGAGAAACCAAAGGCAACTTCTTCACCATGTTTCTG
GCTGGCTCTCTGGCCGTTACGATAGCCATCTACGTGGGTGGTAACGTCTCAGGGGCCCAC
CTGAATCCAGCCTTCTCCCTGGCCATGTGCATCGTTGGACGCCTCCCCTGGGTCAAGCTC
CCCATTTACATCTTGGTGCAGTTGCTGTCTGCTTTCTGTGCTTCGGGAGCCACCTATGTT
CTCTACCATGATGCCCTACAGAACTATACAGGTGGGAACCTGACAGTGACTGGCCCCAAG
GAGACAGCCTCCATTTTTGCCACCTATCCTGCCCCCTATCTGTCCCTGAACAATGGCTTC
CTGGATCAGGTTCTGGGCACCGGGATGCTGATTGTRGGGCTCTTGGCCATCCTGGACAGA
CGGAACAAGGGAGTCCCTGCGGGTCTGGAGCCTGTGGTGGTGGGGATGCTGATCCTGGCC
CTCGGGTTATCCATGGGTGCCAACTGCGGGATTCCACTCAACCCTGCCCGGGACCTGGGC
CCACGTCTCTTCACCTACGTGGCTGGCTGGGGTCCTGAAGTCTTCAGTGCTGGTAATGGC
TGGTGGTGGGTGCCTGTGGTGGCCCCTCTGGTGGGGGCCACCGTTGGCACAGCCACTTAC
CAGCTGTTGGTGGCTCTGCACCACCCTGAGGGCCCAGAGCCAGCTCAGGATCTGGTGTCT
GCTCAACACAAAGCCTCAGAGTTGGAAACTCCTGCCTCAGCTCAGATGCTGGAGTGTAAG
CTATGA
Protein Properties
Number of Residues 301
Molecular Weight 31763.0
Theoretical pI 6.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 28-48
  • 53-73
  • 102-122
  • 157-177
  • 188-208
Protein Sequence
>Aquaporin-10
MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFL
AGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYV
LYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDR
RNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNG
WWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
L
GenBank ID Protein 20372965
UniProtKB/Swiss-Prot ID Q96PS8
UniProtKB/Swiss-Prot Entry Name AQP10_HUMAN
PDB IDs Not Available
GenBank Gene ID AB066105
GeneCard ID AQP10
GenAtlas ID AQP10
HGNC ID HGNC:16029
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Hatakeyama S, Yoshida Y, Tani T, Koyama Y, Nihei K, Ohshiro K, Kamiie JI, Yaoita E, Suda T, Hatakeyama K, Yamamoto T: Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum. Biochem Biophys Res Commun. 2001 Oct 5;287(4):814-9. [PubMed:11573934 ]
  4. Ishibashi K, Morinaga T, Kuwahara M, Sasaki S, Imai M: Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin. Biochim Biophys Acta. 2002 Jul 19;1576(3):335-40. [PubMed:12084581 ]