Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10789
Secondary Accession Numbers
  • 17061
Name HERV-K_1p13.3 provirus ancestral Env polyprotein
Synonyms
  1. Envelope polyprotein
  2. SU
  3. Truncated surface protein
Gene Name Not Available
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Virion
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>576 bp
ATGCCTGGAGCTATAGATGACCATTGCCCTGCTCAACCAGGAGAAGAAGGCACTGCATTT
AATGTTACTATGGGTTATAGATACCCTCCTCTGTGCCTCAGGCATGCAACTCGTTGTATC
CATCTAGAAACTCAAGTCTGGGCTGCTTATCTTCTGGAGAGATTAGCTACAGGAAAATGG
GGACATTTGGTCTCCGGCCTCTCCCTTTGTCCTTTAAGACAAATGAAAAGGGGAGTAATA
GGAGATACCCCATACTTTCAATATAAACCTGTAGGAAAACTATGTCCTAAAAATTTTGAG
GGCCCATCTAAAACTTTAATTTGGGGAGATTGTGTTAACTCACATGCAGTAGTATTAAAA
AATGACTCATATGCTTTAGTAATAGACTGGGCACCAAAGGGCTATTTAAAAAACACTTGC
TCCTCTGGGGGAGGGGAATTCCTGGAGGCTACTTATTTTATTTCTTATTGGGAGGACGAG
GATCATCATCCTACTTTGCATAGGTGGTTCGGCTCATTCTTTACCTTAAAATGGGAAGAT
AAGGACATTACCCTCCACCCCCAAGGCCTTGTATGA
Protein Properties
Number of Residues 191
Molecular Weight 21461.4
Theoretical pI 6.78
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>HERV-K_1p13.3 provirus ancestral Env polyprotein
MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKW
GHLVSGLSLCPLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLK
NDSYALVIDWAPKGYLKNTCSSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWED
KDITLHPQGLV
GenBank ID Protein 34533179
UniProtKB/Swiss-Prot ID P61568
UniProtKB/Swiss-Prot Entry Name ENK13_HUMAN
PDB IDs Not Available
GenBank Gene ID AK126628
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]