Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10799
Secondary Accession Numbers
  • 17073
Name SEC14-like protein 3
Synonyms
  1. Tocopherol-associated protein 2
Gene Name SEC14L3
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
transporter activity
Process
establishment of localization
transport
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.2
SNPs SEC14L3
Gene Sequence
>1203 bp
ATGAGCGGCCGAGTTGGAGACCTGAGCCCCAAACAGGCAGAGACCCTGGCCAAGTTCCGA
GAAAACGTCCAGGATGTGCTTCCTGCCCTGCCCAACCCTGATGATTATTTCCTTCTACGC
TGGCTCCGAGCTCGGAATTTTGACTTGCAGAAGTCGGAGGCTTTGCTCCGCAAGTACATG
GAGTTCCGGAAGACCATGGATATTGACCATATCCTTGATTGGCAGCCCCCAGAGGTGATC
CAGAAGTACATGCCTGGGGGCCTGTGTGGCTATGACCGTGATGGCTGCCCCGTGTGGTAT
GACATCATTGGGCCACTTGATCCCAAGGGGTTGCTCTTCTCAGTCACCAAGCAGGACCTG
CTCAAGACCAAGATGAGGGACTGTGAGCGCATCCTGCATGAGTGTGACCTGCAGACAGAG
AGGCTAGGGAAGAAGATTGAGACCATCGTGATGATATTTGACTGTGAGGGCCTGGGACTG
AAACACTTCTGGAAACCTCTGGTAGAAGTGTACCAGGAGTTCTTTGGCCTCCTTGAAGAG
AATTACCCAGAGACCCTGAAGTTCATGCTCATCGTGAAAGCTACCAAACTGTTCCCTGTG
GGCTACAACCTCATGAAGCCATTCCTGAGTGAGGACACTCGCAGGAAAATTATTGTGTTG
GGAAATAACTGGAAGGAAGGTTTGCTGAAACTCATCAGTCCTGAGGAACTGCCTGCCCAG
TTTGGGGGCACCCTGACTGACCCAGATGGGAACCCCAAATGTTTAACCAAGATTAACTAT
GGCGGGGAGATCCCCAAGTCCATGTACGTGCGGGACCAGGTGAAGACTCAGTACGAGCAC
TCGGTGCAGATCAACCGCGGCTCATCACACCAAGTGGAATACGAGATCCTATTTCCAGGC
TGCGTTCTCAGGTGGCAGTTCTCATCTGATGGTGCGGACATCGGCTTCGGAGTTTTCCTG
AAGACCAAGATGGGGGAGCGACAGCGGGCAGGGGAGATGACAGATGTTCTACCCAGCCAG
CGCTATAACGCCCACATGGTGCCCGAGGATGGGAACCTCACCTGCTCAGAGGCCGGCGTC
TATGTCCTACGCTTCGACAACACCTATAGCTTTGTCCACGCCAAGAAGGTCAGCTTCACA
GTGGAGGTCCTGCTCCCTGACGAGGGCATGCAGAAATATGATAAGGAGCTCACCCCTGTC
TAG
Protein Properties
Number of Residues 400
Molecular Weight 46047.8
Theoretical pI 5.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>SEC14-like protein 3
MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYM
EFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL
LKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEE
NYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQ
FGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGV
YVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UDX4
UniProtKB/Swiss-Prot Entry Name S14L3_HUMAN
PDB IDs Not Available
GenBank Gene ID AY158086
GeneCard ID SEC14L3
GenAtlas ID SEC14L3
HGNC ID HGNC:18655
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Kempna P, Zingg JM, Ricciarelli R, Hierl M, Saxena S, Azzi A: Cloning of novel human SEC14p-like proteins: ligand binding and functional properties. Free Radic Biol Med. 2003 Jun 1;34(11):1458-72. [PubMed:12757856 ]