Hmdb loader

Showing Protein Neutrophil defensin 4 (HMDBP10804)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP10804
Secondary Accession Numbers
  • 17079
Name Neutrophil defensin 4
Synonyms
  1. Defensin, alpha 4
  2. HNP-4
  3. HP-4
Gene Name DEFA4
Protein Type Unknown
Biological Properties
General Function Involved in defense response
Specific Function Has antimicrobial activity against Gram-negative bacteria, and to a lesser extent also against Gram-positive bacteria and fungi. Protects blood cells against infection with HIV-1 (in vitro). Inhibits corticotropin (ACTH)-stimulated corticosterone production
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular space
extracellular region
Process
defense response
response to stimulus
response to stress
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:8
Locus 8p23
SNPs DEFA4
Gene Sequence 
>294 bp
ATGAGGATTATCGCCCTCCTCGCTGCTATTCTCTTGGTAGCCCTCCAGGTCCGGGCAGGC
CCACTCCAGGCAAGAGGTGATGAGGCTCCAGGCCAGGAGCAGCGTGGGCCAGAAGACCAG
GACATATCTATTTCCTTTGCATGGGATAAAAGCTCTGCTCTTCAGGTTTCAGGCTCAACA
AGGGGCATGGTCTGCTCTTGCAGATTAGTATTCTGCCGGCGAACAGAACTTCGTGTTGGG
AACTGCCTCATTGGTGGTGTGAGTTTCACATACTGCTGCACGCGTGTCGATTAA
Protein Properties
Number of Residues 97
Molecular Weight 10504.0
Theoretical pI 8.11
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • None
Protein Sequence 
>Neutrophil defensin 4
MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGST
RGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
GenBank ID Protein 665927
UniProtKB/Swiss-Prot ID P12838
UniProtKB/Swiss-Prot Entry Name DEF4_HUMAN
PDB IDs Not Available
GenBank Gene ID U18745
GeneCard ID DEFA4
GenAtlas ID DEFA4
HGNC ID HGNC:2763
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Gabay JE, Scott RW, Campanelli D, Griffith J, Wilde C, Marra MN, Seeger M, Nathan CF: Antibiotic proteins of human polymorphonuclear leukocytes. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5610-4. [PubMed:2501794 ]
  3. Palfree RG, Sadro LC, Solomon S: The gene encoding the human corticostatin HP-4 precursor contains a recent 86-base duplication and is located on chromosome 8. Mol Endocrinol. 1993 Feb;7(2):199-205. [PubMed:8469233 ]
  4. Singh A, Bateman A, Zhu QZ, Shimasaki S, Esch F, Solomon S: Structure of a novel human granulocyte peptide with anti-ACTH activity. Biochem Biophys Res Commun. 1988 Aug 30;155(1):524-9. [PubMed:2843187 ]
  5. Wilde CG, Griffith JE, Marra MN, Snable JL, Scott RW: Purification and characterization of human neutrophil peptide 4, a novel member of the defensin family. J Biol Chem. 1989 Jul 5;264(19):11200-3. [PubMed:2500436 ]
  6. Ericksen B, Wu Z, Lu W, Lehrer RI: Antibacterial activity and specificity of the six human {alpha}-defensins. Antimicrob Agents Chemother. 2005 Jan;49(1):269-75. [PubMed:15616305 ]
  7. Wu Z, Cocchi F, Gentles D, Ericksen B, Lubkowski J, Devico A, Lehrer RI, Lu W: Human neutrophil alpha-defensin 4 inhibits HIV-1 infection in vitro. FEBS Lett. 2005 Jan 3;579(1):162-6. [PubMed:15620707 ]
  8. Szyk A, Wu Z, Tucker K, Yang D, Lu W, Lubkowski J: Crystal structures of human alpha-defensins HNP4, HD5, and HD6. Protein Sci. 2006 Dec;15(12):2749-60. Epub 2006 Nov 6. [PubMed:17088326 ]