Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10815
Secondary Accession Numbers
  • 17092
Name B2 bradykinin receptor basal promoter, allele BP-58-T
Synonyms Not Available
Gene Name Not Available
Protein Type Unknown
Biological Properties
General Function Involved in receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>122 bp
GCAGAGCTCAGCTGGAGGCGGAGGGGGAAGTGCCCAGGAGGCTGATGACATCATTACCCA
GCCCTTGAAAGATGAGCTGTTCCCGCCGCCACTCCAGCTCTGGCTTCTGGGCTCCGAGGA
GG
Protein Properties
Number of Residues 40
Molecular Weight 4152.5
Theoretical pI 3.47
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>B2 bradykinin receptor basal promoter, allele BP-58-T
QSSAGGGGGSAQEADDIITQPLKDELFPPPLQLWLLGSEE
GenBank ID Protein 1216155
UniProtKB/Swiss-Prot ID Q13833
UniProtKB/Swiss-Prot Entry Name Q13833_HUMAN
PDB IDs Not Available
GenBank Gene ID X91664
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Braun A, Maier E, Kammerer S, Muller B, Roscher AA: A novel sequence polymorphism in the promoter region of the human B2-bradykinin receptor gene. Hum Genet. 1996 May;97(5):688-9. [PubMed:8655154 ]