You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein B2 bradykinin receptor basal promoter, allele BP-58-T (HMDBP10815)
Identification | |
---|---|
HMDB Protein ID | HMDBP10815 |
Secondary Accession Numbers |
|
Name | B2 bradykinin receptor basal promoter, allele BP-58-T |
Synonyms | Not Available |
Gene Name | Not Available |
Protein Type | Unknown |
Biological Properties | |
General Function | Involved in receptor activity |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | Not Available |
Gene Sequence |
>122 bp GCAGAGCTCAGCTGGAGGCGGAGGGGGAAGTGCCCAGGAGGCTGATGACATCATTACCCA GCCCTTGAAAGATGAGCTGTTCCCGCCGCCACTCCAGCTCTGGCTTCTGGGCTCCGAGGA GG |
Protein Properties | |
Number of Residues | 40 |
Molecular Weight | 4152.5 |
Theoretical pI | 3.47 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>B2 bradykinin receptor basal promoter, allele BP-58-T QSSAGGGGGSAQEADDIITQPLKDELFPPPLQLWLLGSEE |
External Links | |
GenBank ID Protein | 1216155 |
UniProtKB/Swiss-Prot ID | Q13833 |
UniProtKB/Swiss-Prot Entry Name | Q13833_HUMAN |
PDB IDs | Not Available |
GenBank Gene ID | X91664 |
GeneCard ID | Not Available |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References |
|