Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10820
Secondary Accession Numbers
  • 17100
Name Gamma-aminobutyric acid receptor-associated protein-like 1
Synonyms
  1. Early estrogen-regulated protein
  2. GABA(A) receptor-associated protein-like 1
  3. GEC-1
  4. Glandular epithelial cell protein 1
Gene Name GABARAPL1
Protein Type Unknown
Biological Properties
General Function Involved in beta-tubulin binding
Specific Function Increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Membrane
  3. Golgi apparatus
  4. Endoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.2
SNPs GABARAPL1
Gene Sequence
>354 bp
ATGAAGTTCCAGTACAAGGAGGACCATCCCTTTGAGTATCGGAAAAAGGAAGGAGAAAAG
ATCCGGAAGAAATATCCGGACAGGGTCCCCGTGATTGTAGAGAAGGCTCCAAAAGCCAGG
GTGCCTGATCTGGACAAGAGGAAGTACCTAGTGCCCTCTGACCTTACTGTTGGCCAGTTC
TACTTCTTAATCCGGAAGAGAATCCACCTGAGACCTGAGGACGCCTTATTCTTCTTTGTC
AACAACACCATCCCTCCCACCAGTGCTACCATGGGCCAACTGTATGAGGACAATCATGAG
GAAGACTATTTTCTGTATGTGGCCTACAGTGATGAGAGTGTCTATGGGAAATGA
Protein Properties
Number of Residues 117
Molecular Weight 14044.0
Theoretical pI 9.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Gamma-aminobutyric acid receptor-associated protein-like 1
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
GenBank ID Protein 13375571
UniProtKB/Swiss-Prot ID Q9H0R8
UniProtKB/Swiss-Prot Entry Name GBRL1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF087847
GeneCard ID GABARAPL1
GenAtlas ID GABARAPL1
HGNC ID HGNC:4068
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  3. Chen C, Li JG, Chen Y, Huang P, Wang Y, Liu-Chen LY: GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J Biol Chem. 2006 Mar 24;281(12):7983-93. Epub 2006 Jan 23. [PubMed:16431922 ]
  4. Xin Y, Yu L, Chen Z, Zheng L, Fu Q, Jiang J, Zhang P, Gong R, Zhao S: Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 2001 Jun 15;74(3):408-13. [PubMed:11414770 ]
  5. Vernier-Magnin S, Muller S, Sallot M, Radom J, Musard JF, Adami P, Dulieu P, Remy-Martin JP, Jouvenot M, Fraichard A: A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP. Biochem Biophys Res Commun. 2001 Jun 1;284(1):118-25. [PubMed:11374880 ]