Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10835
Secondary Accession Numbers
  • 17122
Name Ammonium transporter Rh type B
Synonyms
  1. Rh family type B glycoprotein
  2. Rh type B glycoprotein
  3. Rhesus blood group family type B glycoprotein
Gene Name RHBG
Protein Type Unknown
Biological Properties
General Function Involved in ammonium transmembrane transporter activity
Specific Function Functions as a specific ammonium transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
transepithelial ammonium transport
Cellular Component
cytoplasmic vesicle membrane
basolateral plasma membrane
anchored to plasma membrane
spectrin-associated cytoskeleton
integral to plasma membrane
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
transporter activity
organic cation transmembrane transporter activity
ammonium transmembrane transporter activity
Molecular Function
ammonia transmembrane transporter activity
ammonium transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein
  2. Multi-pass membrane protein
  3. Basolateral cell membrane
  4. Cytoplasmic vesicle membrane
Gene Properties
Chromosome Location 1
Locus 1q21.3
SNPs RHBG
Gene Sequence
>1326 bp
ATGGCCGGGTCTCCTAGCCGCGCCGCGGGCCGGCGACTGCAGCTTCCCCTGCTGTGCCTC
TTCCTCCAGGGCGCCACTGCCGTCCTCTTTGCTGTCTTTGTCCGCTACAACCACAAAACC
GACGCTGCCCTCTGGCACCGGAGCAACCACAGTAACGCGGACAATGAATTTTACTTTCGC
TACCCAAGCTTCCAGGACGTGCATGCCATGGTCTTCGTGGGCTTTGGCTTCCTCATGGTC
TTCCTGCAGCGTTACGGCTTCAGCAGCGTGGGCTTCACCTTCCTCCTGGCCGCCTTTGCC
CTGCAGTGGTCCACACTGGTCCAGGGCTTTCTCCACTCCTTCCACGGTGGCCACATCCAT
GTTGGCGTGGAGAGCATGATCAATGCTGACTTTTGTGCGGGGGCCGTGCTCATCTCCTTT
GGTGCCGTCCTGGGCAAGACCGGGCCTACCCAGCTGCTGCTCATGGCCCTGCTGGAGGTG
GTGCTGTTTGGCATCAATGAGTTTGTGCTCCTTCATCTCCTGGGGGTGAGAGATGCCGGA
GGCTCCATGACTATCCACACCTTTGGTGCCTACTTCGGGCTCGTCCTTTCGCGGGTTCTG
TACAGGCCCCAGCTGGAGAAGAGCAAGCACCGCCAGGGCTCCGTCTACCATTCAGACCTC
TTCGCCATGATTGGGACCATCTTCCTGTGGATCTTCTGGCCTAGCTTCAATGCTGCACTC
ACAGCGCTGGGGGCTGGGCAGCATCGGACGGCCCTCAACACATACTACTCCCTGGCTGCC
AGCACCCTTGGCACCTTTGCCTTGTCAGCCCTTGTAGGGGAAGATGGGAGGCTTGACATG
GTCCACATCCAAAATGCAGCGCTGGCTGGAGGGGTTGTGGTGGGGACCTCAAGTGAAATG
ATGCTGACACCCTTTGGGGCTCTGGCAGCTGGCTTCTTGGCTGGGACTGTCTCCACGCTG
GGGTACAAGTTCTTCACGCCCATCCTTGAATCAAAATTCAAAGTCCAAGACACATGTGGA
GTCCACAACCTCCATGGGATGCCGGGGGTCCTGGGGGCCCTCCTGGGGGTCCTTGTGGCT
GGACTTGCCACCCATGAAGCTTACGGAGATGGCCTGGAGAGTGTGTTTCCACTCATAGCC
GAGGGCCAGCGCAGTGCCACGTCACAGGCCATGCACCAGCTCTTCGGGCTGTTTGTCACA
CTGATGTTTGCCTCTGTGGGCGGGGGCCTTGGAGGGCTCCTGCTGAAGCTACCCTTTCTG
GACTCCCCCCCCAGACTCCCAGCACTACGAGGACCAAGTTCACTGGCAGGTGCCTGGCGA
GCATGA
Protein Properties
Number of Residues 441
Molecular Weight 41645.92
Theoretical pI 6.467
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ammonium transporter Rh type B
MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFR
YPSFQDVHAMVFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIH
VGVESMINADFCAGAVLISFGAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAG
GSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWIFWPSFNAAL
TALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDMVHIQNAALAGGVVVGTSSEM
MLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGVLGALLGVLVA
GLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFL
DSPPRLPALRGPSSLAGAWRA
GenBank ID Protein 55957802
UniProtKB/Swiss-Prot ID Q9H310
UniProtKB/Swiss-Prot Entry Name RHBG_HUMAN
PDB IDs Not Available
GenBank Gene ID AL139130
GeneCard ID RHBG
GenAtlas ID RHBG
HGNC ID HGNC:14572
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Zidi-Yahiaoui N, Mouro-Chanteloup I, D'Ambrosio AM, Lopez C, Gane P, Le van Kim C, Cartron JP, Colin Y, Ripoche P: Human Rhesus B and Rhesus C glycoproteins: properties of facilitated ammonium transport in recombinant kidney cells. Biochem J. 2005 Oct 1;391(Pt 1):33-40. [PubMed:15929723 ]
  5. Liu Z, Peng J, Mo R, Hui C, Huang CH: Rh type B glycoprotein is a new member of the Rh superfamily and a putative ammonia transporter in mammals. J Biol Chem. 2001 Jan 12;276(2):1424-33. [PubMed:11024028 ]
  6. Ludewig U: Electroneutral ammonium transport by basolateral rhesus B glycoprotein. J Physiol. 2004 Sep 15;559(Pt 3):751-9. Epub 2004 Jul 29. [PubMed:15284342 ]
  7. Lopez C, Metral S, Eladari D, Drevensek S, Gane P, Chambrey R, Bennett V, Cartron JP, Le Van Kim C, Colin Y: The ammonium transporter RhBG: requirement of a tyrosine-based signal and ankyrin-G for basolateral targeting and membrane anchorage in polarized kidney epithelial cells. J Biol Chem. 2005 Mar 4;280(9):8221-8. Epub 2004 Dec 17. [PubMed:15611082 ]