You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10837
Secondary Accession Numbers
  • 17124
Name Cyclic nucleotide-gated cation channel beta-1
Synonyms
  1. CNG channel 4
  2. CNG channel beta-1
  3. CNG-4
  4. CNG4
  5. Cyclic nucleotide-gated cation channel 4
  6. Cyclic nucleotide-gated cation channel gamma
  7. Cyclic nucleotide-gated cation channel modulatory subunit
  8. Cyclic nucleotide-gated channel beta-1
  9. GARP
  10. Glutamic acid-rich protein
Gene Name CNGB1
Protein Type Unknown
Biological Properties
General Function Signal transduction mechanisms
Specific Function Isoform GARP2 is a high affinity rod photoreceptor phosphodiesterase (PDE6)-binding protein that modulates its catalytic properties:it is a regulator of spontaneous activation of rod PDE6, thereby serving to lower rod photoreceptor 'dark noise' and allowing these sensory cells to operate at the single photon detection limit
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs CNGB1
Gene Sequence
>3756 bp
ATGTTGGGCTGGGTCCAGAGGGTGCTGCCTCAGCCCCCAGGGACCCCTCGGAAGACCAAG
ATGCAGGAGGAAGAGGAAGTGGAACCAGAGCCAGAGATGGAGGCGGAGGTGGAACCAGAA
CCGAATCCTGAGGAGGCCGAGACAGAGTCCGAGTCCATGCCCCCCGAAGAGTCATTCAAG
GAGGAGGAAGTGGCTGTGGCAGACCCAAGCCCTCAGGAGACCAAGGAGGCTGCCCTTACT
TCCACCATATCCCTCCGGGCCCAGGGCGCTGAGATTTCTGAAATGAATAGTCCCAGCCGC
AGGGTACTGACCTGGCTCATGAAGGGCGTAGAGAAGGTGATCCCGCAGCCTGTTCACAGC
ATCACGGAGGACCCGGCTCAGATCCTGGGGCATGGCAGCACTGGGGACACAGGGTGCACA
GATGAACCCAATGAGGCCCTTGAGGCCCAAGACACTAGGCCTGGGCTGCGGCTGCTTCTG
TGGCTGGAGCAGAATCTGGAAAGAGTGCTTCCTCAGCCCCCCAAATCCTCTGAGGTCTGG
AGAGATGAGCCTGCAGTTGCTACAGGTGCTGCCTCAGACCCAGCGCCTCCAGGACGCCCC
CAGGAAATGGGGCCCAAGCTGCAGGCCCGGGAGACCCCCTCCCTGCCCACACCCATCCCC
CTGCAGCCCAAGGAGGAACCCAAGGAGGCACCAGCTCCAGAGCCCCAGCCCGGCTCCCAG
GCCCAGACCTCCTCCCTGCCACCAACCAGGGACCCTGCCAGGCTGGTGGCATGGGTCCTG
CACAGGCTGGAGATGGCCTTGCCGCAGCCAGTGCTACATGGGAAAATAGGGGAACAGGAG
CCTGACTCCCCTGGGATATGTGATGTGCAGACCATCAGCATCCTTCCTGGAGGACAAGTG
GAGCCTGACCTTGTCCTAGAGGAGGTTGAACCGCCCTGGGAGGATGCCCACCAGGATGTC
AGTACCAGCCCACAGGGTACAGAGGTGGTTCCAGCTTATGAAGAAGAGAACAAAGCTGTG
GAGAAGATGCCCAGAGAGCTGTCCCGGATTGAAGAGGAGAAAGAAGATGAGGAGGAGGAA
GAGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGTGACTGAGGTGCTGCTGGATAGCTGT
GTGGTGTCGCAGGTGGGCGTGGGCCAGAGTGAAGAAGACGGGACCCGGCCCCAGAGCACT
TCAGATCAGAAGCTGTGGGAGGAAGTTGGGGAGGAGGCCAAGAAGGAGGCTGAAGAGAAG
GCCAAGGAGGAGGCCGAGGAGGTGGCTGAAGAGGAGGCTGAAAAGGAGCCCCAGGACTGG
GCGGAGACCAAGGAGGAGCCTGAGGCTGAGGCCGAGGCTGCCAGTTCAGGAGTGCCTGCC
ACGAAACAGCACCCAGAAGTGCAGGTGGAAGATACTGATGCTGATAGCTGCCCCCTCATG
GCAGAAGAGAATCCACCCTCAACCGTGTTGCCGCCACCGTCTCCTGCCAAATCAGACACC
CTTATAGTCCCAAGCTCAGCCTCGGGGACACACAGGAAGAAGCTGCCCTCTGAGGATGAT
GAGGCTGAAGAGCTCAAGGCGTTGTCACCAGCAGAGTCCCCAGTGGTTGCCTGGTCTGAC
CCCACCACCCCGAAGGACACTGATGGCCAGGACCGTGCGGCCTCCACGGCCAGCACAAAT
AGCGCCATCATCAACGACCGGCTCCAGGAGCTGGTGAAGCTCTTCAAGGAGCGGACAGAG
AAAGTGAAGGAGAAACTCATTGACCCTGACGTCACCTCTGATGAGGAGAGCCCCAAGCCC
TCCCCAGCCAAGAAAGCCCCAGAGCCAGCTCCAGACACAAAGCCCGCTGAAGCCGAGCCA
GTGGAAGAGGAGCACTATTGCGACATGCTCTGCTGCAAGTTCAAACACCGCCCCTGGAAG
AAGTACCAGTTTCCCCAGAGCATTGACCCGCTGACCAACCTGATGTATGTCCTATGGCTG
TTCTTCGTGGTGATGGCCTGGAATTGGAACTGTTGGCTGATTCCCGTGCGCTGGGCCTTC
CCCTACCAGACCCCGGACAACATCCACCACTGGCTGCTGATGGATTACCTATGCGACCTC
ATCTACTTCCTGGACATCACCGTGTTCCAGACACGCCTGCAGTTTGTCAGAGGCGGGGAC
ATCATTACGGACAAAAAGGACATGCGAAATAACTACCTGAAGTCTCGCCGCTTCAAGATG
GACCTGCTCAGCCTCCTGCCCTTGGATTTTCTCTATTTGAAAGTCGGTGTGAACCCCCTC
CTCCGCCTGCCCCGCTGTTTAAAGTACATGGCCTTCTTCGAGTTTAACAGCCGCCTGGAA
TCCATCCTCAGCAAAGCCTACGTGTACAGGGTCATCAGGACCACAGCCTACCTTCTCTAC
AGCCTGCATTTGAATTCCTGTCTTTATTACTGGGCATCGGCCTATCAGGGCCTCGGCTCC
ACTCACTGGGTTTACGATGGCGTGGGAAACAGTTATATTCGCTGTTACTACTTTGCTGTG
AAGACCCTCATCACCATCGGGGGGCTGCCTGACCCCAAGACACTCTTTGAAATTGTCTTC
CAGCTGCTGAATTATTTCACGGGCGTCTTTGCTTTCTCTGTGATGATCGGACAGATGAGA
GATGTGGTAGGGGCCGCCACCGCCGGACAGACCTACTACCGCAGCTGCATGGACAGCACG
GTGAAGTACATGAATTTCTACAAGATCCCCAAGTCCGTGCAGAACCGCGTCAAGACCTGG
TACGAGTACACCTGGCACTCGCAAGGCATGCTGGATGAGTCAGAGCTGATGGTGCAGCTT
CCAGACAAGATGCGGCTGGACCTCGCCATCGACGTGAACTACAACATCGTTAGCAAAGTC
GCACTCTTTCAGGGCTGTGACCGGCAGATGATCTTTGACATGCTGAAGAGGCTTCGCTCT
GTTGTCTACCTGCCCAACGACTATGTGTGCAAGAAGGGGGAGATCGGCCGTGAGATGTAC
ATCATCCAGGCAGGGCAAGTGCAGGTCTTGGGCGGCCCTGATGGGAAATCTGTGCTGGTG
ACGCTGAAAGCTGGATCTGTGTTTGGAGAAATAAGCTTGCTGGCTGTTGGGGGCGGGAAC
CGGCGCACGGCCAACGTGGTGGCGCACGGGTTTACCAACCTCTTCATCCTGGATAAGAAG
GACCTGAATGAGATTTTGGTGCATTATCCTGAGTCTCAGAAGTTACTCCGGAAGAAAGCC
AGGCGCATGCTGAGAAGCAACAATAAGCCCAAGGAGGAGAAGAGCGTGCTGATCCTTCCA
CCCCGGGCGGGCACCCCAAAGCTCTTCAACGCTGCCCTCGCTATGACAGGAAAGATGGGT
GGCAAGGGGGCAAAAGGCGGCAAACTTGCTCACCTCCGGGCCCGGCTCAAAGAACTGGCC
GCGCTGGAGGCGGCTGCAAAGCAGCAAGAGTTGGTGGAACAGGCCAAGAGCTCGCAAGAC
GTCAAGGGAGAGGAAGGCTCCGCCGCCCCAGACCAGCACACGCACCCAAAGGAGGCCGCC
ACCGACCCACCCGCGCCCCGGACGCCCCCCGAGCCCCCGGGGTCTCCACCGAGCTCTCCA
CCGCCTGCCTCCCTTGGGAGGCCGGAGGGAGAGGAGGAGGGGCCGGCCGAGCCCGAAGAG
CACTCGGTGAGGATCTGCATGAGCCCGGGCCCGGAGCCGGGAGAGCAGATCCTGTCGGTG
AAGATGCCGGAGGAAAGGGAGGAGAAGGCGGAGTAA
Protein Properties
Number of Residues 1251
Molecular Weight 139676.6
Theoretical pI 4.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 657-675
  • 690-708
  • 734-753
  • 791-813
  • 858-877
  • 962-982
Protein Sequence
>Cyclic nucleotide-gated cation channel beta-1
MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHS
ITEDPAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVW
RDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPIPLQPKEEPKEAPAPEPQPGSQ
AQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPPWEDAHQDVSTSPQGTEVVPAYEEENKAVEKMPRELSRIEEEKEDEEEE
EEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDGTRPQSTSDQKLWEEVGEEAKKEAEEK
AKEEAEEVAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLM
AEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSD
PTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKP
SPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWL
FFVVMAWNWNCWLIPVRWAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGD
IITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLE
SILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAV
KTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDST
VKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKV
ALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLV
TLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKA
RRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELA
ALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSP
PPASLGRPEGEEEGPAEPEEHSVRICMSPGPEPGEQILSVKMPEEREEKAE
GenBank ID Protein 114205399
UniProtKB/Swiss-Prot ID Q14028
UniProtKB/Swiss-Prot Entry Name CNGB1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001297.4
GeneCard ID CNGB1
GenAtlas ID CNGB1
HGNC ID HGNC:2151
References
General References
  1. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  2. Bradley J, Bonigk W, Yau KW, Frings S: Calmodulin permanently associates with rat olfactory CNG channels under native conditions. Nat Neurosci. 2004 Jul;7(7):705-10. Epub 2004 Jun 13. [PubMed:15195096 ]
  3. Chen TY, Peng YW, Dhallan RS, Ahamed B, Reed RR, Yau KW: A new subunit of the cyclic nucleotide-gated cation channel in retinal rods. Nature. 1993 Apr 22;362(6422):764-7. [PubMed:7682292 ]
  4. Ardell MD, Makhija AK, Oliveira L, Miniou P, Viegas-Pequignot E, Pittler SJ: cDNA, gene structure, and chromosomal localization of human GAR1 (CNCG3L), a homolog of the third subunit of bovine photoreceptor cGMP-gated channel. Genomics. 1995 Jul 1;28(1):32-8. [PubMed:7590744 ]
  5. Ardell MD, Aragon I, Oliveira L, Porche GE, Burke E, Pittler SJ: The beta subunit of human rod photoreceptor cGMP-gated cation channel is generated from a complex transcription unit. FEBS Lett. 1996 Jul 1;389(2):213-8. [PubMed:8766832 ]
  6. Grunwald ME, Yu WP, Yu HH, Yau KW: Identification of a domain on the beta-subunit of the rod cGMP-gated cation channel that mediates inhibition by calcium-calmodulin. J Biol Chem. 1998 Apr 10;273(15):9148-57. [PubMed:9535905 ]
  7. Ardell MD, Bedsole DL, Schoborg RV, Pittler SJ: Genomic organization of the human rod photoreceptor cGMP-gated cation channel beta-subunit gene. Gene. 2000 Mar 21;245(2):311-8. [PubMed:10717482 ]
  8. Pentia DC, Hosier S, Cote RH: The glutamic acid-rich protein-2 (GARP2) is a high affinity rod photoreceptor phosphodiesterase (PDE6)-binding protein that modulates its catalytic properties. J Biol Chem. 2006 Mar 3;281(9):5500-5. Epub 2006 Jan 3. [PubMed:16407240 ]
  9. Batra-Safferling R, Abarca-Heidemann K, Korschen HG, Tziatzios C, Stoldt M, Budyak I, Willbold D, Schwalbe H, Klein-Seetharaman J, Kaupp UB: Glutamic acid-rich proteins of rod photoreceptors are natively unfolded. J Biol Chem. 2006 Jan 20;281(3):1449-60. Epub 2005 Nov 9. [PubMed:16280326 ]
  10. Bareil C, Hamel CP, Delague V, Arnaud B, Demaille J, Claustres M: Segregation of a mutation in CNGB1 encoding the beta-subunit of the rod cGMP-gated channel in a family with autosomal recessive retinitis pigmentosa. Hum Genet. 2001 Apr;108(4):328-34. [PubMed:11379879 ]