Showing Protein Potassium voltage-gated channel subfamily E member 2 (HMDBP10842)

• 17132

1. MinK-related peptide 1
2. Minimum potassium ion channel-related peptide 1
3. Potassium channel subunit beta MiRP1

• Acebutolol Action Pathway
• Alprenolol Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Bopindolol Action Pathway
• Bupranolol Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Diltiazem Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Esmolol Action Pathway
• Felodipine Action Pathway
• Flecainide Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Ibutilide Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Labetalol Action Pathway
• Levobunolol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Metipranolol Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nebivolol Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Penbutolol Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Practolol Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Propranolol Action Pathway
• Quinidine Action Pathway
• Sotalol Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Verapamil Action Pathway

1. Membrane
2. Single-pass type I membrane protein

>372 bp
ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATT
ACTTATATGGACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAA
GTTGATGCTGAGAACTTCTACTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTC
TCTTTCATCATCGTGGCCATCCTGGTGAGCACTGTGAAATCCAAGAGACGGGAACACTCC
AATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGGAAAAGTACAAGAGCCAAATC
TTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGCTGGGTTCAAA
ATGTCCCCCTGA

• ISK_Channel (PF02060 )

• None

• 49-69

>Potassium voltage-gated channel subfamily E member 2
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
2. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
3. Abbott GW, Sesti F, Splawski I, Buck ME, Lehmann MH, Timothy KW, Keating MT, Goldstein SA: MiRP1 forms IKr potassium channels with HERG and is associated with cardiac arrhythmia. Cell. 1999 Apr 16;97(2):175-87. [PubMed:10219239 ]
4. Millat G, Chevalier P, Restier-Miron L, Da Costa A, Bouvagnet P, Kugener B, Fayol L, Gonzalez Armengod C, Oddou B, Chanavat V, Froidefond E, Perraudin R, Rousson R, Rodriguez-Lafrasse C: Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 Sep;70(3):214-27. [PubMed:16922724 ]
5. Abbott GW, Goldstein SA: Disease-associated mutations in KCNE potassium channel subunits (MiRPs) reveal promiscuous disruption of multiple currents and conservation of mechanism. FASEB J. 2002 Mar;16(3):390-400. [PubMed:11874988 ]
6. Tinel N, Diochot S, Lauritzen I, Barhanin J, Lazdunski M, Borsotto M: M-type KCNQ2-KCNQ3 potassium channels are modulated by the KCNE2 subunit. FEBS Lett. 2000 Sep 1;480(2-3):137-41. [PubMed:11034315 ]
7. Tinel N, Diochot S, Borsotto M, Lazdunski M, Barhanin J: KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel. EMBO J. 2000 Dec 1;19(23):6326-30. [PubMed:11101505 ]
8. Isbrandt D, Friederich P, Solth A, Haverkamp W, Ebneth A, Borggrefe M, Funke H, Sauter K, Breithardt G, Pongs O, Schulze-Bahr E: Identification and functional characterization of a novel KCNE2 (MiRP1) mutation that alters HERG channel kinetics. J Mol Med (Berl). 2002 Aug;80(8):524-32. Epub 2002 Jun 28. [PubMed:12185453 ]
9. Yang Y, Xia M, Jin Q, Bendahhou S, Shi J, Chen Y, Liang B, Lin J, Liu Y, Liu B, Zhou Q, Zhang D, Wang R, Ma N, Su X, Niu K, Pei Y, Xu W, Chen Z, Wan H, Cui J, Barhanin J, Chen Y: Identification of a KCNE2 gain-of-function mutation in patients with familial atrial fibrillation. Am J Hum Genet. 2004 Nov;75(5):899-905. Epub 2004 Sep 13. [PubMed:15368194 ]