Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10843
Secondary Accession Numbers
  • 17133
Name Potassium voltage-gated channel subfamily D member 2
Synonyms
  1. Voltage-gated potassium channel subunit Kv4.2
Gene Name KCND2
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits
Pathways
  • 3-Methylthiofentanyl Action Pathway
  • Alfentanil Action Pathway
  • Alvimopan Action Pathway
  • Anileridine Action Pathway
  • Benzocaine Action Pathway
  • Bupivacaine Action Pathway
  • Buprenorphine Action Pathway
  • Carfentanil Action Pathway
  • Chloroprocaine Action Pathway
  • Citalopram Action Pathway
  • Cocaine Action Pathway
  • Codeine Action Pathway
  • Desipramine Action Pathway
  • Dezocine Action Pathway
  • Dibucaine Action Pathway
  • Dihydromorphine Action Pathway
  • Dimethylthiambutene Action Pathway
  • Diphenoxylate Action Pathway
  • Escitalopram Action Pathway
  • Ethylmorphine Action Pathway
  • Fentanyl Action Pathway
  • Fluoxetine Action Pathway
  • Heroin Action Pathway
  • Hydrocodone Action Pathway
  • Hydromorphone Action Pathway
  • Imipramine Action Pathway
  • Ketobemidone Action Pathway
  • Levallorphan Action Pathway
  • Levobupivacaine Action Pathway
  • Levomethadyl Acetate Action Action Pathway
  • Levorphanol Action Pathway
  • Lidocaine (Local Anaesthetic) Action Pathway
  • Mepivacaine Action Pathway
  • Methadone Action Pathway
  • Methadyl Acetate Action Pathway
  • Morphine Action Pathway
  • Nalbuphine Action Pathway
  • Naloxone Action Pathway
  • Naltrexone Action Pathway
  • Nicotine Action Pathway
  • Oxybuprocaine Action Pathway
  • Oxycodone Action Pathway
  • Oxymorphone Action Pathway
  • Pentazocine Action Pathway
  • Prilocaine Action Pathway
  • Procaine Action Pathway
  • Proparacaine Action Pathway
  • Propoxyphene Action Pathway
  • Remifentanil Action Pathway
  • Ropivacaine Action Pathway
  • Sufentanil Action Pathway
  • Tramadol Action Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
protein complex
Function
binding
protein binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell projection
  4. dendrite
Gene Properties
Chromosome Location Chromosome:7
Locus 7q31
SNPs KCND2
Gene Sequence
>1893 bp
ATGGCGGCGGGGGTGGCAGCGTGGCTGCCTTTTGCAAGGGCAGCGGCTATCGGGTGGATG
CCTGTGGCCTCGGGGCCTATGCCGGCTCCCCCGAGGCAGGAGAGGAAAAGGACCCAAGAT
GCTCTCATTGTGCTGAATGTGAGTGGCACCCGCTTCCAGACGTGGCAGGACACCCTGGAA
CGTTACCCAGACACTCTACTGGGCAGTTCTGAGAGGGACTTTTTCTACCACCCAGAAACT
CAGCAGTATTTCTTTGACCGTGACCCAGACATCTTCCGCCACATCCTGAATTTCTACCGC
ACTGGGAAGCTCCACTATCCTCGCCACGAGTGCATCTCTGCTTACGATGAAGAACTGGCC
TTCTTTGGCCTCATCCCGGAAATCATCGGCGACTGCTGTTATGAGGAGTACAAGGATCGC
AGGCGAGAGAACGCCGAGCGCCTGCAGGACGACGCGGATACCGACACCGCTGGGGAGAGC
GCCTTGCCCACCATGACTGCAAGGCAGAGGGTCTGGAGGGCCTTCGAGAACCCCCACACC
AGCACGATGGCCCTGGTGTTCTACTATGTCACGGGGTTTTTCATTGCCGTCTCTGTCATC
GCGAATGTGGTGGAAACAGTGCCGTGCGGATCAAGCCCAGGTCACATTAAAGAACTGCCC
TGTGGAGAGCGGTATGCTGTGGCCTTCTTCTGCTTGGACACGGCCTGCGTCATGATCTTC
ACAGTTGAGTATTTGCTTCGCCTGGCTGCAGCGCCTAGTCGTTACCGTTTTGTGCGTAGT
GTCATGAGTATCATCGACGTGGTGGCCATCCTGCCTTATTACATTGGGCTGGTGATGACA
GACAATGAGGACGTCAGCGGAGCCTTTGTCACACTCCGAGTCTTCCGGGTCTTCAGGATC
TTTAAGTTTTCCCGCCACTCTCAAGGCCTGCGCATCCTGGGGTACACACTGAAGAGTTGT
GCCTCAGAATTGGGCTTCTTGCTTTTCTCGCTCACCATGGCTATCATCATTTTCGCTACG
GTTATGTTCTACGCAGAGAAGGGCTCTTCAGCAAGCAAGTTCACCAGCATCCCTGCAGCC
TTCTGGTACACCATCGTCACCATGACAACACTGGGGTATGGCGACATGGTACCAAAAACC
ATAGCAGGGAAGATTTTCGGGTCTATCTGCTCACTGAGCGGAGTCTTGGTCATCGCGCTA
CCCGTGCCTGTGATCGTGTCTAACTTCAGTCGGATCTACCACCAAAACCAACGAGCGGAC
AAACGAAGGGCACAGAAGAAAGCGAGGCTGGCCAGGATCCGGGCAGCCAAAAGTGGAAGT
GCAAATGCCTACATGCAGAGCAAGCGGAGTGGGTTACTGAGCAACCAACTGCAGTCCTCG
GAGGATGAACCGGCCTTCGTTAGCAAATCTGGATCCAGCTTCGAGACGCAACACCACCAC
CTGCTTCACTGCCTGGAGAAAACCACGAACCATGAGTTTGTGGATGAACAAGTCTTTGAA
GAAAGCTGCATGGAAGTGGCCACTGTTAATCGCCCTTCAAGTCACAGCCCCTCCCTCTCT
TCCCAACAAGGAGTCACCAGCACTTGCTGCTCACGGAGACACAAAAAAACTTTCCGAATC
CCAAATGCCAATGTGTCAGGAAGTCATAGAGGCAGCGTGCAAGAACTCAGTACAATTCAG
ATCAGATGTGTGGAGAGAACTCCACTATCCAACAGCCGATCCAGCTTAAATGCCAAAATG
GAAGAGTGTGTCAAACTAAACTGTGAACAACCTTACGTGACCACAGCAATAATTAGCATT
CCAACACCTCCAGTAACCACCCCAGAAGGCGACGACAGGCCCGAGTCTCCTGAGTATTCG
GGAGGAAACATCGTCAGGGTGTCTGCTTTGTAA
Protein Properties
Number of Residues 630
Molecular Weight 70535.8
Theoretical pI 8.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 184-204
  • 225-245
  • 260-280
  • 290-310
  • 324-344
  • 385-405
Protein Sequence
>Potassium voltage-gated channel subfamily D member 2
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
GenBank ID Protein 4530478
UniProtKB/Swiss-Prot ID Q9NZV8
UniProtKB/Swiss-Prot Entry Name KCND2_HUMAN
PDB IDs
GenBank Gene ID AF121104
GeneCard ID KCND2
GenAtlas ID KCND2
HGNC ID HGNC:6238
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  4. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ: Modulation of A-type potassium channels by a family of calcium sensors. Nature. 2000 Feb 3;403(6769):553-6. [PubMed:10676964 ]
  5. Lin YL, Chen CY, Cheng CP, Chang LS: Protein-protein interactions of KChIP proteins and Kv4.2. Biochem Biophys Res Commun. 2004 Aug 27;321(3):606-10. [PubMed:15358149 ]
  6. Scannevin RH, Wang K, Jow F, Megules J, Kopsco DC, Edris W, Carroll KC, Lu Q, Xu W, Xu Z, Katz AH, Olland S, Lin L, Taylor M, Stahl M, Malakian K, Somers W, Mosyak L, Bowlby MR, Chanda P, Rhodes KJ: Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1. Neuron. 2004 Feb 19;41(4):587-98. [PubMed:14980207 ]
  7. Bahring R, Dannenberg J, Peters HC, Leicher T, Pongs O, Isbrandt D: Conserved Kv4 N-terminal domain critical for effects of Kv channel-interacting protein 2.2 on channel expression and gating. J Biol Chem. 2001 Jun 29;276(26):23888-94. Epub 2001 Apr 3. [PubMed:11287421 ]
  8. Kim LA, Furst J, Butler MH, Xu S, Grigorieff N, Goldstein SA: Ito channels are octomeric complexes with four subunits of each Kv4.2 and K+ channel-interacting protein 2. J Biol Chem. 2004 Feb 13;279(7):5549-54. Epub 2003 Nov 17. [PubMed:14623880 ]
  9. Kim LA, Furst J, Gutierrez D, Butler MH, Xu S, Goldstein SA, Grigorieff N: Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21 Angstrom resolution. Neuron. 2004 Feb 19;41(4):513-9. [PubMed:14980201 ]
  10. Morohashi Y, Hatano N, Ohya S, Takikawa R, Watabiki T, Takasugi N, Imaizumi Y, Tomita T, Iwatsubo T: Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4. J Biol Chem. 2002 Apr 26;277(17):14965-75. Epub 2002 Feb 14. [PubMed:11847232 ]
  11. Kong W, Po S, Yamagishi T, Ashen MD, Stetten G, Tomaselli GF: Isolation and characterization of the human gene encoding Ito: further diversity by alternative mRNA splicing. Am J Physiol. 1998 Dec;275(6 Pt 2):H1963-70. [PubMed:9843794 ]
  12. Zhu XR, Wulf A, Schwarz M, Isbrandt D, Pongs O: Characterization of human Kv4.2 mediating a rapidly-inactivating transient voltage-sensitive K+ current. Receptors Channels. 1999;6(5):387-400. [PubMed:10551270 ]
  13. Isbrandt D, Leicher T, Waldschutz R, Zhu X, Luhmann U, Michel U, Sauter K, Pongs O: Gene structures and expression profiles of three human KCND (Kv4) potassium channels mediating A-type currents I(TO) and I(SA). Genomics. 2000 Mar 1;64(2):144-54. [PubMed:10729221 ]
  14. Petrecca K, Miller DM, Shrier A: Localization and enhanced current density of the Kv4.2 potassium channel by interaction with the actin-binding protein filamin. J Neurosci. 2000 Dec 1;20(23):8736-44. [PubMed:11102480 ]
  15. Schrader LA, Anderson AE, Mayne A, Pfaffinger PJ, Sweatt JD: PKA modulation of Kv4.2-encoded A-type potassium channels requires formation of a supramolecular complex. J Neurosci. 2002 Dec 1;22(23):10123-33. [PubMed:12451113 ]
  16. Jerng HH, Qian Y, Pfaffinger PJ: Modulation of Kv4.2 channel expression and gating by dipeptidyl peptidase 10 (DPP10). Biophys J. 2004 Oct;87(4):2380-96. [PubMed:15454437 ]
  17. El-Haou S, Balse E, Neyroud N, Dilanian G, Gavillet B, Abriel H, Coulombe A, Jeromin A, Hatem SN: Kv4 potassium channels form a tripartite complex with the anchoring protein SAP97 and CaMKII in cardiac myocytes. Circ Res. 2009 Mar 27;104(6):758-69. doi: 10.1161/CIRCRESAHA.108.191007. Epub 2009 Feb 12. [PubMed:19213956 ]