Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10844
Secondary Accession Numbers
  • 17134
Name Potassium voltage-gated channel subfamily D member 3
Synonyms
  1. Voltage-gated potassium channel subunit Kv4.3
Gene Name KCND3
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
protein complex
Function
binding
protein binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Membrane
  3. Multi-pass membrane protein
  4. sarcolemma
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.3
SNPs KCND3
Gene Sequence
>1968 bp
ATGGCGGCCGGAGTTGCGGCCTGGCTGCCTTTTGCCCGGGCTGCGGCCATCGGGTGGATG
CCGGTGGCCAACTGCCCCATGCCCCTGGCCCCGGCCGACAAGAACAAGCGGCAGGATGAG
CTGATTGTCCTCAACGTGAGTGGGCGGAGGTTCCAGACCTGGAGGACCACGCTGGAGCGC
TACCCGGACACCCTGCTGGGCAGCACGGAGAAGGAGTTCTTCTTCAACGAGGACACCAAG
GAGTACTTCTTCGACCGGGACCCCGAGGTGTTCCGCTGCGTGCTCAACTTCTACCGCACG
GGGAAGCTGCACTACCCGCGCTACGAGTGCATCTCTGCCTACGACGACGAGCTGGCCTTC
TACGGCATCCTCCCGGAGATCATCGGGGACTGCTGCTACGAGGAGTACAAGGACCGCAAG
AGGGAGAACGCCGAGCGGCTCATGGACGACAACGACTCGGAGAACAACCAGGAGTCCATG
CCCTCGCTCAGCTTCCGCCAGACCATGTGGCGGGCCTTCGAGAACCCCCACACCAGCACG
CTGGCCCTGGTCTTCTACTACGTGACTGGCTTCTTCATCGCTGTCTCGGTCATCACCAAC
GTGGTGGAGACGGTGCCGTGCGGCACGGTCCCGGGCAGCAAGGAGCTGCCGTGCGGGGAG
CGCTACTCGGTGGCCTTCTTCTGCCTGGACACGGCGTGCGTCATGATCTTCACCGTGGAG
TACCTCCTGCGGCTCTTCGCGGCTCCCAGCCGCTACCGCTTCATCCGCAGCGTCATGAGC
ATCATCGACGTGGTGGCCATCATGCCCTACTACATCGGTCTGGTCATGACCAACAACGAG
GACGTGTCCGGCGCCTTCGTCACGCTCCGGGTCTTCCGCGTCTTCAGGATCTTCAAGTTT
TCCCGCCACTCCCAGGGCCTGCGGATCCTGGGCTACACACTGAAGAGCTGTGCCTCCGAA
CTGGGCTTTCTTCTCTTCTCCCTCACCATGGCCATCATCATCTTTGCCACTGTGATGTTT
TATGCCGAGAAGGGCTCCTCGGCCAGCAAGTTCACAAGCATCCCTGCCTCGTTTTGGTAC
ACCATTGTCACCATGACCACACTGGGGTACGGAGACATGGTGCCTAAGACGATTGCAGGG
AAGATCTTCGGCTCCATCTGCTCCTTGAGTGGCGTCCTGGTCATTGCCCTGCCAGTCCCT
GTGATTGTTTCCAACTTTAGCCGGATTTACCACCAGAATCAGAGAGCTGATAAACGCAGG
GCACAAAAGAAGGCCCGCCTTGCCAGGATCCGTGTGGCCAAAACAGGCAGTTCGAATGCA
TACCTGCACAGCAAGCGCAACGGGCTCCTCAACGAGGCGCTGGAGCTGACGGGCACCCCA
GAAGAGGAGCACATGGGCAAGACCACCTCACTCATCGAGAGCCAGCATCATCACCTGCTG
CACTGCCTGGAAAAAACCACTGGGTTGTCCTATCTTGTGGATGATCCCCTGTTATCTGTA
CGAACCTCCACCATCAAGAACCACGAGTTTATTGATGAGCAGATGTTTGAGCAGAACTGC
ATGGAGAGTTCAATGCAGAACTACCCATCCACAAGAAGTCCCTCACTGTCCAGCCACCCA
GGCCTCACTACCACCTGCTGCTCCCGTCGTAGTAAGAAGACCACACACCTGCCCAATTCT
AACCTGCCAGCTACTCGCCTGCGCAGCATGCAAGAGCTCAGCACGATCCACATCCAGGGC
AGTGAGCAGCCCTCCCTCACAACCAGTCGCTCCAGCCTTAATTTGAAAGCAGACGACGGA
CTGAGACCAAACTGCAAAACATCCCAGATCACCACAGCCATCATCAGCATCCCCACTCCC
CCAGCGCTAACCCCAGAGGGGGAAAGTCGGCCACCCCCTGCCAGCCCAGGCCCCAACACG
AACATTCCTTCCATAGCCAGCAATGTTGTCAAGGTCTCCGCCTTGTAA
Protein Properties
Number of Residues 655
Molecular Weight 73450.5
Theoretical pI 8.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 182-202
  • 222-242
  • 257-277
  • 287-307
  • 321-341
  • 382-402
Protein Sequence
>Potassium voltage-gated channel subfamily D member 3
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
GenBank ID Protein 27436984
UniProtKB/Swiss-Prot ID Q9UK17
UniProtKB/Swiss-Prot Entry Name KCND3_HUMAN
PDB IDs
GenBank Gene ID NM_004980.3
GeneCard ID KCND3
GenAtlas ID KCND3
HGNC ID HGNC:6239
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Scannevin RH, Wang K, Jow F, Megules J, Kopsco DC, Edris W, Carroll KC, Lu Q, Xu W, Xu Z, Katz AH, Olland S, Lin L, Taylor M, Stahl M, Malakian K, Somers W, Mosyak L, Bowlby MR, Chanda P, Rhodes KJ: Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1. Neuron. 2004 Feb 19;41(4):587-98. [PubMed:14980207 ]
  5. Wang H, Yan Y, Liu Q, Huang Y, Shen Y, Chen L, Chen Y, Yang Q, Hao Q, Wang K, Chai J: Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits. Nat Neurosci. 2007 Jan;10(1):32-9. Epub 2006 Dec 24. [PubMed:17187064 ]
  6. Deschenes I, Tomaselli GF: Modulation of Kv4.3 current by accessory subunits. FEBS Lett. 2002 Sep 25;528(1-3):183-8. [PubMed:12297301 ]
  7. Kong W, Po S, Yamagishi T, Ashen MD, Stetten G, Tomaselli GF: Isolation and characterization of the human gene encoding Ito: further diversity by alternative mRNA splicing. Am J Physiol. 1998 Dec;275(6 Pt 2):H1963-70. [PubMed:9843794 ]
  8. Isbrandt D, Leicher T, Waldschutz R, Zhu X, Luhmann U, Michel U, Sauter K, Pongs O: Gene structures and expression profiles of three human KCND (Kv4) potassium channels mediating A-type currents I(TO) and I(SA). Genomics. 2000 Mar 1;64(2):144-54. [PubMed:10729221 ]
  9. El-Haou S, Balse E, Neyroud N, Dilanian G, Gavillet B, Abriel H, Coulombe A, Jeromin A, Hatem SN: Kv4 potassium channels form a tripartite complex with the anchoring protein SAP97 and CaMKII in cardiac myocytes. Circ Res. 2009 Mar 27;104(6):758-69. doi: 10.1161/CIRCRESAHA.108.191007. Epub 2009 Feb 12. [PubMed:19213956 ]
  10. Dilks D, Ling HP, Cockett M, Sokol P, Numann R: Cloning and expression of the human kv4.3 potassium channel. J Neurophysiol. 1999 Apr;81(4):1974-7. [PubMed:10200233 ]