Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10845
Secondary Accession Numbers
  • 17135
Name Potassium voltage-gated channel subfamily KQT member 5
Synonyms
  1. KQT-like 5
  2. Potassium channel subunit alpha KvLQT5
  3. Voltage-gated potassium channel subunit Kv7.5
Gene Name KCNQ5
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel which contributes to M-type current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons. May contribute, with other potassium channels, to the molecular diversity of an heterogeneous population of M-channels, varying in kinetic and pharmacological properties, which underlie this physiologically important current. Insensitive to tetraethylammonium, but inhibited by barium, linopirdine and XE991. Activated by niflumic acid and the anticonvulsant retigabine. Muscarine suppresses KCNQ5 current in Xenopus oocytes in which cloned KCNQ5 channels were coexpressed with M(1) muscarinic receptors
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
protein complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:6
Locus 6q14
SNPs KCNQ5
Gene Sequence
>2799 bp
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGC
GGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAG
TCGGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTTGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGG
GGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGAAGCCGCCTCTCTTACACGAGTAGCCAG
AGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTCCTCCTTGTCTTTGGTTGC
TTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTC
TTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAG
CCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAA
ACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTAT
GCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCG
TCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTA
ACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCA
CTTCCTGCCGGCATTCTTGGCTCAGGTTTTGCATTAAAAGTACAAGAACAACACCGCCAG
AAACACTTTGAGAAAAGAAGGAACCCAGCTGCCAACCTCATTCAGTGTGTTTGGCGTAGT
TACGCAGCTGATGAGAAATCTGTTTCCATTGCAACCTGGAAGCCACACTTGAAGGCCTTG
CACACCTGCAGCCCTACCAAGAAAGAACAAGGGGAAGCATCAAGCAGTCAGAAGCTAAGT
TTTAAGGAGCGAGTGCGCATGGCTAGCCCCAGGGGCCAGAGTATTAAGAGCCGACAAGCC
TCAGTAGGTGACAGGAGGTCCCCAAGCACCGACATCACAGCCGAGGGCAGTCCCACCAAA
GTGCAGAAGAGCTGGAGCTTCAACGACCGAACCCGCTTCCGGCCCTCGCTGCGCCTCAAA
AGTTCTCAGCCAAAACCAGTGATAGATGCTGACACAGCCCTTGGCACTGATGATGTATAT
GATGAAAAAGGATGCCAGTGTGATGTATCAGTGGAAGACCTCACCCCACCACTTAAAACT
GTCATTCGAGCTATCAGAATTATGAAATTTCATGTTGCAAAACGGAAGTTTAAGGAAACA
TTACGTCCATATGATGTAAAAGATGTCATTGAACAATATTCTGCTGGTCATCTGGACATG
TTGTGTAGAATTAAAAGCCTTCAAACACGTGTTGATCAAATTCTTGGAAAAGGGCAAATC
ACATCAGATAAGAAGAGCCGAGAGAAAATAACAGCAGAACATGAGACCACAGACGATCTC
AGTATGCTCGGTCGGGTGGTCAAGGTTGAAAAACAGGTACAGTCCATAGAATCCAAGCTG
GACTGCCTACTAGACATCTATCAACAGGTCCTTCGGAAAGGCTCTGCCTCAGCCCTCGCT
TTGGCTTCATTCCAGATCCCACCTTTTGAATGTGAACAGACATCTGACTATCAAAGCCCT
GTGGATAGCAAAGATCTTTCGGGTTCCGCACAAAACAGTGGCTGCTTATCCAGATCAACT
AGTGCCAACATCTCGAGAGGCCTGCAGTTCATTCTGACGCCAAATGAGTTCAGTGCCCAG
ACTTTCTACGCGCTTAGCCCTACTATGCACAGTCAAGCAACACAGGTGCCAATTAGTCAA
AGCGATGGCTCAGCAGTGGCAGCCACCAACACCATTGCAAACCAAATAAATACGGCACCC
AAGCCAGCAGCCCCAACAACTTTACAGATCCCACCTCCTCTCCCAGCCATCAAGCATCTG
CCCAGGCCAGAAACTCTGCACCCTAACCCTGCAGGCTTACAGGAAAGCATTTCTGACGTC
ACCACCTGCCTTGTTGCCTCCAAGGAAAATGTTCAGGTTGCACAGTCAAATCTCACCAAG
GACCGTTCTATGAGGAAAAGCTTTGACATGGGAGGAGAAACTCTGTTGTCTGTCTGTCCC
ATGGTGCCGAAGGACTTGGGCAAATCTTTGTCTGTGCAAAACCTGATCAGGTCGACCGAG
GAACTGAATATACAACTTTCAGGGAGTGAGTCAAGTGGCTCCAGAGGCAGCCAAGATTTT
TACCCCAAATGGAGGGAATCCAAATTGTTTATAACTGATGAAGAGGTGGGTCCCGAAGAG
ACAGAGACAGACACTTTTGATGCCGCACCGCAGCCTGCCAGGGAAGCTGCCTTTGCATCA
GACTCTCTAAGGACTGGAAGGTCACGATCATCTCAGAGCATTTGTAAGGCAGGAGAAAGT
ACAGATGCCCTCAGCTTGCCTCATGTCAAACTGAAATAA
Protein Properties
Number of Residues 932
Molecular Weight 102178.0
Theoretical pI 10.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 126-146
  • 157-177
  • 201-221
  • 230-252
  • 267-287
  • 326-346
Protein Sequence
>Potassium voltage-gated channel subfamily KQT member 5
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLK
SSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
LRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDL
SMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQIPPFECEQTSDYQSP
VDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQ
SDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDV
TTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFAS
DSLRTGRSRSSQSICKAGESTDALSLPHVKLK
GenBank ID Protein 9651967
UniProtKB/Swiss-Prot ID Q9NR82
UniProtKB/Swiss-Prot Entry Name KCNQ5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF249278
GeneCard ID KCNQ5
GenAtlas ID KCNQ5
HGNC ID HGNC:6299
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Wickenden AD, Zou A, Wagoner PK, Jegla T: Characterization of KCNQ5/Q3 potassium channels expressed in mammalian cells. Br J Pharmacol. 2001 Jan;132(2):381-4. [PubMed:11159685 ]
  5. Lerche C, Scherer CR, Seebohm G, Derst C, Wei AD, Busch AE, Steinmeyer K: Molecular cloning and functional expression of KCNQ5, a potassium channel subunit that may contribute to neuronal M-current diversity. J Biol Chem. 2000 Jul 21;275(29):22395-400. [PubMed:10787416 ]
  6. Schroeder BC, Hechenberger M, Weinreich F, Kubisch C, Jentsch TJ: KCNQ5, a novel potassium channel broadly expressed in brain, mediates M-type currents. J Biol Chem. 2000 Aug 4;275(31):24089-95. [PubMed:10816588 ]