Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10847
Secondary Accession Numbers
  • 17137
Name Potassium voltage-gated channel subfamily A member 3
Synonyms
  1. HGK5
  2. HLK3
  3. HPCN3
  4. Voltage-gated K(+) channel HuKIII
  5. Voltage-gated potassium channel subunit Kv1.3
Gene Name KCNA3
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
protein complex
Function
binding
protein binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.3
SNPs KCNA3
Gene Sequence
>1728 bp
ATGGACGAGCGCCTCAGCCTTCTGCGCTCGCCGCCGCCGCCCTCAGCCCGCCACCGCGCC
CACCCTCCTCAGCGCCCAGCGAGCAGCGGCGGTGCCCACACGCTGGTGAACCACGGCTAC
GCGGAGCCCGCCGCAGGCCGCGAGCTGCCGCCCGACATGACCGTGGTGCCCGGGGACCAC
CTGCTGGAGCCGGAGGTGGCCGATGGTGGAGGGGCCCCGCCTCAAGGCGGCTGTGGCGGC
GGCGGCTGCGACCGCTACGAGCCGCTGCCGCCCTCACTGCCGGCCGCGGGCGAGCAGGAC
TGCTGCGGGGAGCGCGTGGTCATCAACATCTCCGGGCTGCGCTTCGAGACGCAGCTGAAG
ACCCTTTGCCAGTTCCCCGAGACGCTGCTGGGCGACCCCAAGCGGCGCATGAGGTACTTC
GACCCGCTCCGCAACGAGTACTTCTTCGACCGCAACCGGCCCAGCTTCGACGCCATCCTC
TACTACTATCAGTCCGGGGGCCGCATCCGCCGGCCGGTCAACGTGCCCATCGACATTTTC
TCCGAGGAGATCCGCTTCTACCAGCTGGGCGAGGAGGCCATGGAGAAGTTCCGCGAGGAC
GAGGGCTTCCTGCGGGAGGAGGAGCGGCCCTTGCCCCGCCGCGACTTCCAGCGCCAGGTG
TGGCTGCTCTTCGAGTACCCCGAGAGCTCCGGGCCGGCCCGGGGCATCGCCATCGTGTCC
GTGCTGGTCATCCTCATCTCCATTGTCATCTTCTGCCTGGAGACGCTGCCGGAGTTCCGC
GACGAGAAGGACTACCCCGCCTCGACGTCGCAGGACTCATTCGAAGCAGCCGGCAACAGC
ACGTCGGGGTCCCGCGCAGGAGCCTCCAGCTTCTCCGATCCCTTCTTCGTGGTGGAGACG
CTGTGCATCATCTGGTTCTCCTTCGAACTGCTGGTGCGGTTCTTCGCTTGTCCTAGCAAA
GCCACCTTCTCGCGAAACATCATGAACCTGATCGACATTGTGGCCATCATTCCTTATTTT
ATCACTCTGGGTACCGAGCTGGCCGAACGACAGGGCAATGGACAGCAGGCCATGTCTCTG
GCCATCCTGAGGGTCATCCGCCTGGTAAGGGTCTTCCGCATCTTCAAGCTGTCGCGCCAC
TCCAAGGGGCTGCAGATCCTCGGGCAAACGCTGAAGGCGTCCATGCGGGAGCTGGGATTG
CTCATCTTCTTCCTCTTTATTGGGGTCATCCTTTTCTCCAGCGCGGTCTACTTTGCCGAG
GCAGACGACCCCACTTCAGGTTTCAGCAGCATCCCGGATGCCTTCTGGTGGGCAGTGGTA
ACCATGACAACAGTGGGTTACGGCGATATGCACCCAGTGACCATAGGGGGCAAGATTGTG
GGATCTCTCTGTGCCATCGCCGGTGTCTTGACCATCGCATTGCCAGTTCCCGTGATTGTT
TCCAACTTCAATTACTTCTACCACCGGGAGACAGAAGGGGAAGAGCAATCCCAGTACATG
CACGTGGGAAGTTGCCAGCACCTCTCCTCTTCAGCCGAGGAGCTCCGAAAAGCAAGGAGT
AACTCGACTCTGAGTAAGTCGGAGTATATGGTGATCGAAGAGGGGGGTATGAACCATAGC
GCTTTCCCCCAGACCCCTTTCAAAACGGGCAATTCCACTGCCACCTGCACCACGAACAAT
AATCCCAACTCTTGTGTCAACATCAAAAAGATATTCACCGATGTTTAA
Protein Properties
Number of Residues 575
Molecular Weight 63841.1
Theoretical pI 5.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 235-253
  • 295-316
  • 328-348
  • 363-381
  • 398-417
  • 459-481
Protein Sequence
>Potassium voltage-gated channel subfamily A member 3
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
GenBank ID Protein 55664008
UniProtKB/Swiss-Prot ID P22001
UniProtKB/Swiss-Prot Entry Name KCNA3_HUMAN
PDB IDs
GenBank Gene ID AL365361
GeneCard ID KCNA3
GenAtlas ID KCNA3
HGNC ID HGNC:6221
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Philipson LH, Hice RE, Schaefer K, LaMendola J, Bell GI, Nelson DJ, Steiner DF: Sequence and functional expression in Xenopus oocytes of a human insulinoma and islet potassium channel. Proc Natl Acad Sci U S A. 1991 Jan 1;88(1):53-7. [PubMed:1986382 ]
  4. Folander K, Douglass J, Swanson R: Confirmation of the assignment of the gene encoding Kv1.3, a voltage-gated potassium channel (KCNA3) to the proximal short arm of human chromosome 1. Genomics. 1994 Sep 1;23(1):295-6. [PubMed:7829094 ]
  5. Attali B, Romey G, Honore E, Schmid-Alliana A, Mattei MG, Lesage F, Ricard P, Barhanin J, Lazdunski M: Cloning, functional expression, and regulation of two K+ channels in human T lymphocytes. J Biol Chem. 1992 Apr 25;267(12):8650-7. [PubMed:1373731 ]
  6. Cai YC, Osborne PB, North RA, Dooley DC, Douglass J: Characterization and functional expression of genomic DNA encoding the human lymphocyte type n potassium channel. DNA Cell Biol. 1992 Mar;11(2):163-72. [PubMed:1547020 ]