Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10852
Secondary Accession Numbers
  • 17142
Name Folate receptor beta
Synonyms
  1. FBP
  2. FR-beta
  3. Folate receptor 2
  4. Folate receptor, fetal/placental
  5. Placental folate-binding protein
Gene Name FOLR2
Protein Type Unknown
Biological Properties
General Function Involved in folic acid binding
Specific Function Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
  4. Secreted (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.3-q13.5
SNPs FOLR2
Gene Sequence
>768 bp
ATGGTCTGGAAATGGATGCCACTTCTGCTGCTTCTGGTCTGTGTAGCCACCATGTGCAGT
GCCCAGGACAGGACTGATCTCCTCAATGTCTGTATGGATGCCAAGCACCACAAGACAAAG
CCAGGTCCTGAGGACAAGCTGCATGACCAATGCAGTCCCTGGAAGAAGAATGCCTGCTGC
ACAGCCAGCACCAGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTACAACTTTAACTGG
GACCACTGCGGCAAGATGGAGCCCGCCTGCAAGCGCCACTTCATCCAGGACACCTGTCTC
TATGAGTGCTCACCCAACCTGGGGCCCTGGATCCAGCAGGTGAATCAGACGTGGCGAAAA
GAACGCTTCCTGGATGTGCCCTTATGCAAAGAGGACTGTCAGCGCTGGTGGGAGGATTGT
CACACCTCCCACACGTGCAAGAGCAACTGGCACAGAGGATGGGACTGGACCTCAGGAGTT
AACAAGTGCCCAGCTGGGGCTCTCTGCCGCACCTTTGAGTCCTACTTCCCCACTCCAGCT
GCCCTTTGTGAAGGCCTCTGGAGTCACTCATACAAGGTCAGCAACTACAGCCGAGGGAGC
GGCCGCTGCATCCAGATGTGGTTTGATTCAGCCCAGGGCAACCCCAACGAGGAAGTGGCG
AGGTTCTATGCTGCAGCCATGCATGTGAATGCTGGTGAGATGCTTCATGGGACTGGGGGT
CTCCTGCTCAGTCTGGCCCTGATGCTGCAACTCTGGCTCCTTGGCTGA
Protein Properties
Number of Residues 255
Molecular Weight 29279.3
Theoretical pI 7.56
Pfam Domain Function
Signals
  • 1-16
Transmembrane Regions
  • None
Protein Sequence
>Folate receptor beta
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
GenBank ID Protein 182414
UniProtKB/Swiss-Prot ID P14207
UniProtKB/Swiss-Prot Entry Name FOLR2_HUMAN
PDB IDs Not Available
GenBank Gene ID J02876
GeneCard ID FOLR2
GenAtlas ID FOLR2
HGNC ID HGNC:3793
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Yan W, Ratnam M: Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal. Biochemistry. 1995 Nov 7;34(44):14594-600. [PubMed:7578066 ]
  3. Page ST, Owen WC, Price K, Elwood PC: Expression of the human placental folate receptor transcript is regulated in human tissues. Organization and full nucleotide sequence of the gene. J Mol Biol. 1993 Feb 20;229(4):1175-83. [PubMed:8445646 ]
  4. Ratnam M, Marquardt H, Duhring JL, Freisheim JH: Homologous membrane folate binding proteins in human placenta: cloning and sequence of a cDNA. Biochemistry. 1989 Oct 3;28(20):8249-54. [PubMed:2605182 ]
  5. Sadasivan E, Cedeno MM, Rothenberg SP: Characterization of the gene encoding a folate-binding protein expressed in human placenta. Identification of promoter activity in a G-rich SP1 site linked with the tandemly repeated GGAAG motif for the ets encoded GA-binding protein. J Biol Chem. 1994 Feb 18;269(7):4725-35. [PubMed:8106441 ]
  6. Freisheim JH, Price EM, Ratnam M: Folate coenzyme and antifolate transport proteins in normal and neoplastic cells. Adv Enzyme Regul. 1989;29:13-26. [PubMed:2561247 ]
  7. Wang J, Shen F, Yan W, Wu M, Ratnam M: Proteolysis of the carboxyl-terminal GPI signal independent of GPI modification as a mechanism for selective protein secretion. Biochemistry. 1997 Nov 25;36(47):14583-92. [PubMed:9398177 ]