You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10857
Secondary Accession Numbers
  • 17147
Name 5-hydroxytryptamine receptor 3B
Synonyms
  1. 5-HT3-B
  2. 5-HT3B
  3. Serotonin receptor 3B
Gene Name HTR3B
Protein Type Unknown
Biological Properties
General Function Involved in extracellular ligand-gated ion channel activity
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
postsynaptic membrane
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
serotonin receptor activity
g-protein coupled receptor activity
g-protein coupled amine receptor activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q23.1
SNPs HTR3B
Gene Sequence
>1326 bp
ATGTTGTCAAGTGTAATGGCTCCCCTGTGGGCCTGCATCCTGGTGGCTGCAGGAATTCTA
GCCACAGATACACATCATCCCCAGGATTCTGCTCTGTATCATCTCAGCAAGCAGCTATTA
CAGAAATATCATAAAGAAGTGAGACCTGTTTACAACTGGACCAAGGCCACCACAGTCTAC
CTGGACCTGTTCGTCCATGCTATATTGGATGTGGATGCAGAGAATCAAATATTAAAGACA
AGTGTATGGTACCAAGAGGTCTGGAATGATGAATTTTTATCCTGGAACTCCAGCATGTTT
GATGAGATTAGAGAGATCTCCCTACCTCTAAGTGCCATCTGGGCCCCCGATATCATCATC
AATGAGTTTGTGGACATTGAAAGATACCCTGACCTTCCCTATGTTTATGTGAACTCATCT
GGGACCATTGAGAACTATAAGCCCATCCAGGTGGTCTCTGCGTGCAGTTTAGAGACATAT
GCTTTTCCATTTGATGTCCAGAATTGCAGCCTGACCTTCAAGAGCATTCTGCATACAGTG
GAAGACGTAGACCTGGCCTTTCTGAGGAGCCCAGAAGACATTCAGCATGACAAAAAGGCG
TTTTTGAATGACAGTGAGTGGGAACTTCTATCTGTGTCCTCCACATACAGCATCCTGCAG
AGCAGCGCTGGAGGATTTGCACAGATTCAGTTTAATGTGGTGATGCGCAGGCACCCCCTG
GTCTATGTCGTGAGTCTGCTGATTCCTAGCATCTTTCTCATGCTGGTGGACCTGGGGAGC
TTCTACCTGCCACCCAACTGCCGAGCCAGGATTGTGTTCAAGACCAGTGTGCTGGTGGGC
TACACCGTCTTCAGGGTCAACATGTCCAACCAGGTGCCACGGAGTGTAGGGAGCACCCCT
CTGATTGGGCACTTCTTCACCATCTGCATGGCCTTCTTGGTTCTCAGCTTAGCTAAGTCC
ATCGTGTTGGTCAAATTCCTCCATGATGAGCAGCGTGGTGGACAGGAGCAGCCCTTCTTG
TGCCTTCGAGGGGACACCGATGCTGACAGGCCTAGAGTGGAACCCAGGGCCCAACGTGCT
GTGGTAACAGAGTCCTCGCTGTATGGAGAGCACCTGGCCCAGCCAGGAACCCTGAAGGAA
GTCTGGTCGCAGCTTCAATCTATCAGCAACTACCTCCAAACTCAGGACCAGACAGACCAA
CAGGAGGCAGAGTGGCTGGTCCTCCTGTCCCGCTTTGACCGACTGCTCTTCCAAAGCTAC
CTTTTCATGCTGGGGATCTACACCATCACTCTGTGCTCCCTCTGGGCACTGTGGGGCGGC
GTGTGA
Protein Properties
Number of Residues 441
Molecular Weight 50291.3
Theoretical pI 4.99
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • 239-259
  • 269-286
  • 304-324
  • 415-435
Protein Sequence
>5-hydroxytryptamine receptor 3B
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV
GenBank ID Protein 4218949
UniProtKB/Swiss-Prot ID O95264
UniProtKB/Swiss-Prot Entry Name 5HT3B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF080582
GeneCard ID HTR3B
GenAtlas ID HTR3B
HGNC ID HGNC:5298
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Davies PA, Pistis M, Hanna MC, Peters JA, Lambert JJ, Hales TG, Kirkness EF: The 5-HT3B subunit is a major determinant of serotonin-receptor function. Nature. 1999 Jan 28;397(6717):359-63. [PubMed:9950429 ]
  3. Dubin AE, Huvar R, D'Andrea MR, Pyati J, Zhu JY, Joy KC, Wilson SJ, Galindo JE, Glass CA, Luo L, Jackson MR, Lovenberg TW, Erlander MG: The pharmacological and functional characteristics of the serotonin 5-HT(3A) receptor are specifically modified by a 5-HT(3B) receptor subunit. J Biol Chem. 1999 Oct 22;274(43):30799-810. [PubMed:10521471 ]
  4. Kelley SP, Dunlop JI, Kirkness EF, Lambert JJ, Peters JA: A cytoplasmic region determines single-channel conductance in 5-HT3 receptors. Nature. 2003 Jul 17;424(6946):321-4. [PubMed:12867984 ]
  5. Niesler B, Walstab J, Combrink S, Moller D, Kapeller J, Rietdorf J, Bonisch H, Gothert M, Rappold G, Bruss M: Characterization of the novel human serotonin receptor subunits 5-HT3C,5-HT3D, and 5-HT3E. Mol Pharmacol. 2007 Jul;72(1):8-17. Epub 2007 Mar 28. [PubMed:17392525 ]
  6. Frank B, Niesler B, Bondy B, Spath M, Pongratz DE, Ackenheil M, Fischer C, Rappold G: Mutational analysis of serotonin receptor genes: HTR3A and HTR3B in fibromyalgia patients. Clin Rheumatol. 2004 Aug;23(4):338-44. Epub 2004 May 7. [PubMed:15293096 ]
  7. Yamada K, Hattori E, Iwayama Y, Ohnishi T, Ohba H, Toyota T, Takao H, Minabe Y, Nakatani N, Higuchi T, Detera-Wadleigh SD, Yoshikawa T: Distinguishable haplotype blocks in the HTR3A and HTR3B region in the Japanese reveal evidence of association of HTR3B with female major depression. Biol Psychiatry. 2006 Jul 15;60(2):192-201. Epub 2006 Feb 17. [PubMed:16487942 ]
  8. Tzvetkov MV, Meineke C, Oetjen E, Hirsch-Ernst K, Brockmoller J: Tissue-specific alternative promoters of the serotonin receptor gene HTR3B in human brain and intestine. Gene. 2007 Jan 15;386(1-2):52-62. Epub 2006 Aug 23. [PubMed:17010535 ]
  9. Frank B, Niesler B, Nothen MM, Neidt H, Propping P, Bondy B, Rietschel M, Maier W, Albus M, Rappold G: Investigation of the human serotonin receptor gene HTR3B in bipolar affective and schizophrenic patients. Am J Med Genet B Neuropsychiatr Genet. 2004 Nov 15;131B(1):1-5. [PubMed:15389765 ]