You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10858
Secondary Accession Numbers
  • 17148
Name 5-hydroxytryptamine receptor 1E
Synonyms
  1. 5-HT-1E
  2. 5-HT1E
  3. S31
  4. Serotonin receptor 1E
Gene Name HTR1E
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:6
Locus 6q14-q15
SNPs HTR1E
Gene Sequence
>1098 bp
ATGAACATCACAAACTGTACCACAGAGGCCAGCATGGCTATAAGACCCAAGACCATCACT
GAGAAGATGCTCATTTGCATGACTCTGGTGGTCATCACCACCCTCACCACGTTGCTGAAC
TTGGCTGTGATCATGGCTATTGGCACCACCAAGAAGCTCCACCAGCCTGCCAACTACCTA
ATCTGTTCTCTGGCCGTGACGGACCTCCTGGTGGCAGTGCTCGTCATGCCCCTGAGCATC
ATCTACATTGTCATGGATCGCTGGAAGCTTGGGTACTTCCTCTGTGAGGTGTGGCTGAGT
GTGGACATGACCTGCTGCACCTGCTCCATCCTCCACCTCTGTGTCATTGCCCTGGACAGG
TACTGGGCCATCACCAATGCTATTGAATACGCCAGGAAGAGGACGGCCAAGAGGGCCGCG
CTGATGATCCTTACCGTCTGGACCATCTCCATTTTCATCTCCATGCCCCCTCTGTTCTGG
AGAAGCCACCGCCGCCTAAGCCCTCCCCCTAGTCAGTGCACCATCCAGCACGACCATGTT
ATCTACACCATTTACTCCACGCTGGGTGCGTTTTATATCCCCTTGACTTTGATACTGATT
CTCTATTACCGGATTTACCACGCGGCCAAGAGCCTTTACCAGAAAAGGGGATCAAGTCGG
CACTTAAGCAACAGAAGCACAGATAGCCAGAATTCTTTTGCAAGTTGTAAACTTACACAG
ACTTTCTGTGTGTCTGACTTCTCCACCTCAGACCCTACCACAGAGTTTGAAAAGTTCCAT
GCCTCCATCAGGATCCCCCCCTTCGACAATGATCTAGATCACCCAGGAGAACGTCAGCAG
ATCTCTAGCACCAGGGAACGGAAGGCAGCACGCATCCTGGGGCTGATTCTGGGTGCATTC
ATTTTATCCTGGCTGCCATTTTTCATCAAAGAGTTGATTGTGGGTCTGAGCATCTACACC
GTGTCCTCGGAAGTGGCCGACTTTCTGACGTGGCTCGGTTATGTGAATTCTCTGATCAAC
CCTCTGCTCTATACGAGTTTTAATGAAGACTTTAAGCTGGCTTTTAAAAAGCTCATTAGA
TGCCGAGAGCATACTTAG
Protein Properties
Number of Residues 365
Molecular Weight 41681.6
Theoretical pI 8.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 23-47
  • 60-81
  • 97-118
  • 139-159
  • 180-201
  • 292-314
  • 325-347
Protein Sequence
>5-hydroxytryptamine receptor 1E
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P28566
UniProtKB/Swiss-Prot Entry Name 5HT1E_HUMAN
PDB IDs Not Available
GenBank Gene ID M91467
GeneCard ID HTR1E
GenAtlas ID HTR1E
HGNC ID HGNC:5291
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  4. Kitano T, Liu YH, Ueda S, Saitou N: Human-specific amino acid changes found in 103 protein-coding genes. Mol Biol Evol. 2004 May;21(5):936-44. Epub 2004 Mar 10. [PubMed:15014171 ]
  5. McAllister G, Charlesworth A, Snodin C, Beer MS, Noble AJ, Middlemiss DN, Iversen LL, Whiting P: Molecular cloning of a serotonin receptor from human brain (5HT1E): a fifth 5HT1-like subtype. Proc Natl Acad Sci U S A. 1992 Jun 15;89(12):5517-21. [PubMed:1608964 ]
  6. Levy FO, Gudermann T, Birnbaumer M, Kaumann AJ, Birnbaumer L: Molecular cloning of a human gene (S31) encoding a novel serotonin receptor mediating inhibition of adenylyl cyclase. FEBS Lett. 1992 Jan 20;296(2):201-6. [PubMed:1733778 ]
  7. Zgombick JM, Schechter LE, Macchi M, Hartig PR, Branchek TA, Weinshank RL: Human gene S31 encodes the pharmacologically defined serotonin 5-hydroxytryptamine1E receptor. Mol Pharmacol. 1992 Aug;42(2):180-5. [PubMed:1513320 ]