You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10859
Secondary Accession Numbers
  • 17149
Name 5-hydroxytryptamine receptor 5A
Synonyms
  1. 5-HT-5
  2. 5-HT-5A
  3. 5-HT5A
  4. Serotonin receptor 5A
Gene Name HTR5A
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q36.1
SNPs HTR5A
Gene Sequence
>1074 bp
ATGGATTTACCAGTGAACCTAACCTCCTTTTCCCTCTCCACCCCCTCCCCTTTGGAGACC
AACCACAGCCTCGGCAAAGACGACCTGCGCCCCAGCTCGCCCCTGCTCTCGGTCTTCGGA
GTGCTTATTCTCACCTTGCTGGGCTTTCTGGTGGCGGCGACGTTCGCCTGGAACCTGCTG
GTGCTGGCGACCATCCTCCGTGTACGCACCTTCCACCGCGTGCCCCACAACCTGGTGGCA
TCCATGGCCGTCTCGGATGTCCTGGTGGCCGCGCTGGTCATGCCGCTGAGCCTGGTGCAC
GAGCTGTCCGGGCGCCGCTGGCAGCTAGGTCGGAGGCTGTGCCAGCTTTGGATCGCGTGC
GACGTGCTTTGCTGCACGGCCAGCATCTGGAACGTGACGGCCATAGCCCTGGACCGCTAC
TGGTCCATCACGCGCCACATGGAATACACGCTCCGCACCCGCAAGTGCGTCTCCAACGTC
ATGATCGCGCTCACCTGGGCACTCTCCGCTGTCATCTCTCTGGCCCCGCTGCTTTTTGGC
TGGGGAGAGACGTACTCTGAGGGCAGCGAGGAGTGCCAGGTAAGCCGCGAGCCTTCCTAC
GCCGTGTTCTCCACCGTAGGCGCCTTCTACCTGCCGCTCTGTGTGGTGCTCTTCGTGTAC
TGGAAGATCTACAAGGCTGCCAAGTTCCGCGTGGGCTCCAGGAAGACCAATAGCGTCTCA
CCCATATCCGAAGCTGTGGAGGTGAAGGACTCTGCCAAACAGCCCCAGATGGTGTTCACG
GTCCGCCACGCCACCGTCACCTTCCAGCCAGAAGGGGACACGTGGCGGGAGCAGAAGGAG
CAGCGGGCCGCCCTCATGGTGGGCATCCTCATTGGCGTGTTCGTGCTCTGCTGGATCCCC
TTCTTTCTCACCGAGCTCATCAGTCCCCTCTGCTCCTGTGACATCCCCGCCATCTGGAAA
AGCATCTTCCTGTGGCTTGGCTACTCCAACTCCTTCTTTAACCCCCTGATCTATACGGCT
TTCAACAAGAACTACAACAGCGCCTTCAAGAACTTCTTTTCTAGGCAACACTGA
Protein Properties
Number of Residues 357
Molecular Weight 40254.7
Theoretical pI 8.82
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 41-63
  • 79-99
  • 116-137
  • 159-181
  • 199-219
  • 283-303
  • 321-341
Protein Sequence
>5-hydroxytryptamine receptor 5A
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
GenBank ID Protein 20379144
UniProtKB/Swiss-Prot ID P47898
UniProtKB/Swiss-Prot Entry Name 5HT5A_HUMAN
PDB IDs Not Available
GenBank Gene ID AF498985
GeneCard ID HTR5A
GenAtlas ID HTR5A
HGNC ID HGNC:5300
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Rees S, den Daas I, Foord S, Goodson S, Bull D, Kilpatrick G, Lee M: Cloning and characterisation of the human 5-HT5A serotonin receptor. FEBS Lett. 1994 Dec 5;355(3):242-6. [PubMed:7988681 ]