You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10860
Secondary Accession Numbers
  • 17151
Name Metabotropic glutamate receptor 8
Synonyms
  1. mGluR8
Gene Name GRM8
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q31.3-q32.1
SNPs GRM8
Gene Sequence
>2727 bp
ATGGTATGCGAGGGAAAGCGATCAGCCTCTTGCCCTTGTTTCTTCCTCTTGACCGCCAAG
TTCTACTGGATCCTCACAATGATGCAAAGAACTCACAGCCAGGAGTATGCCCATTCCATA
CGGGTGGATGGGGACATTATTTTGGGGGGTCTCTTCCCTGTCCACGCAAAGGGAGAGAGA
GGGGTGCCTTGTGGGGAGCTGAAGAAGGAAAAGGGGATTCACAGACTGGAGGCCATGCTT
TATGCAATTGACCAGATTAACAAGGACCCTGATCTCCTTTCCAACATCACTCTGGGTGTC
CGCATCCTCGACACGTGCTCTAGGGACACCTATGCTTTGGAGCAGTCACTAACATTCGTG
CAGGCATTAATAGAGAAAGATGCTTCGGATGTGAAGTGTGCTAATGGAGATCCACCCATT
TTCACCAAGCCCGACAAGATTTCTGGCGTCATAGGTGCTGCAGCAAGCTCCGTGTCCATC
ATGGTTGCTAACATTTTAAGACTTTTTAAGATACCTCAAATCAGCTATGCATCCACAGCC
CCAGAGCTAAGTGATAACACCAGGTATGACTTTTTCTCTGCAGTGGTTCCGCCTGACTCC
TACCAAGCCCAAGCCATGGTGGACATCGTGACAGCACTGGGATGGAATTATGTTTCTACA
CTGGCTTCTGAGGGGAACTATGGTGAGAGCGGTGTGGAGGCCTTCACCCAGATCTCGAGG
GAGATTGGTGGTGTTTGCATTGCTCAGTCACAGAAAATCCCACGTGAACCAAGACCTGGA
GAATTTGAAAAAATTATCAAACGCCTGCTGGAAACACCTAATGCTCGAGCAGTGATTATG
TTTGCCAATGAGGATGACATCAGGAGGATATTGGAAGCAGCAAAAAAACTAAACCAAAGT
GGGCATTTTCTCTGGATTGGCTCAGATAGTTGGGGATCCAAAATAGCACCTGTCTATCAG
CAGGAGGAGATTGCAGAAGGGGCTGTGACAATTTTGCCCAAACGAGCATCAATTGATGGA
TTTGATCGATACTTTAGAAGCCGAACTCTTGCCAATAATCGAAGAAATGTGTGGTTTGCA
GAATTCTGGGAGGAGAATTTTGGCTGCAAGTTAGGATCACATGGGAAAAGGAACAGTCAT
ATAAAGAAATGCACAGGGCTGGAGCGAATTGCTCGGGATTCATCTTATGAACAGGAAGGA
AAGGTCCAATTTGTAATTGATGCTGTATATTCCATGGCTTACGCCCTGCACAATATGCAC
AAAGATCTCTGCCCTGGATACATTGGCCTTTGTCCACGAATGAGTACCATTGATGGGAAA
GAGCTACTTGGTTATATTCGGGCTGTAAATTTTAATGGCAGTGCTGGCACTCCTGTCATC
TTTAATGAAAACGGAGATGCTCCTGGACGTTATGATATCTTCCAGTATCAAATAACCAAC
AAAAGCACAGAGTACAAAGTCATCGGCCACTGGACCAATCAGCTTCATCTAAAAGTGGAA
GACATGCAGTGGGCTCATAGAGAACATACTCACCCGGCGTCTGTCTGCAGCCTGCCGTGT
AAGCCAGGGGAGAGGAAGAAAACGGTGAAAGGGGTCCCTTGCTGCTGGCACTGTGAACGC
TGTGAAGGTTACAACTACCAGGTGGATGAGCTGTCCTGTGAACTTTGCCCTCTGGATCAG
AGACCCAACATGAACCGCACAGGCTGCCAGCTTATCCCCATCATCAAGTTGGAGTGGCAT
TCTCCCTGGGCTGTGGTGCCTGTGTTTGTTGCAATATTGGGAATCATCGCCACCACCTTT
GTGATCGTGACCTTTGTCCGCTATAATGACACACCTATCGTGAGGGCTTCAGGACGCGAA
CTTAGTTACGTGCTCCTAACGGGGATTTTTCTCTGTTATTCAATCACGTTTTTAATGATT
GCAGGACCAGATACAATCATATGCTCCTTCCGACGGGTCTTCCTAGGACTTGGCATGTGT
TTCAGCTATGCAGCCCTTCTGACCAAAACAAACCGTATCCACCGAATATTTGAGCAGGGG
AAGAAATCTGTCACAGCGCCCAAGTTCATTAGTCCAGCATCTCAGCTGGTGATCACCTTC
AGCCTCATCTCCGTCCAGCTCCTTGGAGTGTTTGTCTGGTTTGTTGTGGATCCCCCCCAC
ATCATCATTGACTATGGAGAGCAGCGGACACTAGATCCAGAGAAGGCCAGGGGAGTGCTC
AAGTGTGACATTTCTGATCTCTCACTCATTTGTTCACTTGGATACAGTATCCTCTTGATG
GTCACTTGTACTGTTTATGCCATTAAAACGAGAGGTGTCCCAGAGACTTTCAATGAAGCC
AAACCTATTGGATTTACCATGTATACCACCTGCATCATTTGGTTAGCTTTCATCCCCATC
TTTTTTGGTACAGCCCAGTCAGCAGAAAAGATGTACATCCAGACAACAACACTTACTGTC
TCCATGAGTTTAAGTGCTTCAGTATCTCTGGGCATGCTCTATATGCCCAAGGTTTATATT
ATAATTTTTCATCCAGAACAGAATGTTCAAAAACGCAAGAGGAGCTTCAAGGCTGTGGTG
ACAGCTGCCACCATGCAAAGCAAACTGATCCAAAAAGGAAATGACAGACCAAATGGCGAG
GTGAAAAGTGAACTCTGTGAGAGTCTTGAAACCAACACTTCCTCTACCAAGACAACATAT
ATCAGTTACACGAATCATTCAATCTGA
Protein Properties
Number of Residues 908
Molecular Weight 101739.6
Theoretical pI 8.21
Pfam Domain Function
Signals
  • 1-33
Transmembrane Regions
  • 584-608
  • 621-641
  • 648-668
  • 696-716
  • 747-768
  • 782-803
  • 819-843
Protein Sequence
>Metabotropic glutamate receptor 8
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
GenBank ID Protein 2435410
UniProtKB/Swiss-Prot ID O00222
UniProtKB/Swiss-Prot Entry Name GRM8_HUMAN
PDB IDs Not Available
GenBank Gene ID U95025
GeneCard ID GRM8
GenAtlas ID GRM8
HGNC ID HGNC:4600
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Scherer SW, Soder S, Duvoisin RM, Huizenga JJ, Tsui LC: The human metabotropic glutamate receptor 8 (GRM8) gene: a disproportionately large gene located at 7q31.3-q32.1. Genomics. 1997 Sep 1;44(2):232-6. [PubMed:9299241 ]
  4. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. [PubMed:9473604 ]
  5. Malherbe P, Kratzeisen C, Lundstrom K, Richards JG, Faull RL, Mutel V: Cloning and functional expression of alternative spliced variants of the human metabotropic glutamate receptor 8. Brain Res Mol Brain Res. 1999 Apr 20;67(2):201-10. [PubMed:10216218 ]