You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10861
Secondary Accession Numbers
  • 17152
Name Metabotropic glutamate receptor 4
Synonyms
  1. mGluR4
Gene Name GRM4
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs GRM4
Gene Sequence
>2739 bp
ATGCCTGGGAAGAGAGGCTTGGGCTGGTGGTGGGCCCGGCTGCCCCTTTGCCTGCTCCTC
AGCCTTTACGGCCCCTGGATGCCTTCCTCCCTGGGAAAGCCCAAAGGCCACCCTCACATG
AATTCCATCCGCATAGATGGGGACATCACACTGGGAGGCCTGTTCCCGGTGCATGGCCGG
GGCTCAGAGGGCAAGCCCTGTGGAGAACTTAAGAAGGAAAAGGGCATCCACCGGCTGGAG
GCCATGCTGTTCGCCCTGGATCGCATCAACAACGACCCGGACCTGCTGCCTAACATCACG
CTGGGCGCCCGCATTCTGGACACCTGCTCCAGGGACACCCATGCCCTCGAGCAGTCGCTG
ACCTTTGTGCAGGCGCTCATCGAGAAGGATGGCACAGAGGTCCGCTGTGGCAGTGGCGGC
CCACCCATCATCACCAAGCCTGAACGTGTGGTGGGTGTCATCGGTGCTTCAGGGAGCTCG
GTCTCCATCATGGTGGCCAACATCCTTCGCCTCTTCAAGATACCCCAGATCAGCTACGCC
TCCACAGCGCCAGACCTGAGTGACAACAGCCGCTACGACTTCTTCTCCCGCGTGGTGCCC
TCGGACACGTACCAGGCCCAGGCCATGGTGGACATCGTCCGTGCCCTCAAGTGGAACTAT
GTGTCCACAGTGGCCTCGGAGGGCAGCTATGGTGAGAGCGGTGTGGAGGCCTTCATCCAG
AAGTCCCGTGAGGACGGGGGCGTGTGCATCGCCCAGTCGGTGAAGATACCACGGGAGCCC
AAGGCAGGCGAGTTCGACAAGATCATCCGCCGCCTCCTGGAGACTTCGAACGCCAGGGCA
GTCATCATCTTTGCCAACGAGGATGACATCAGGCGTGTGCTGGAGGCAGCACGAAGGGCC
AACCAGACAGGCCATTTCTTCTGGATGGGCTCTGACAGCTGGGGCTCCAAGATTGCACCT
GTGCTGCACCTGGAGGAGGTGGCTGAGGGTGCTGTCACGATCCTCCCCAAGAGGATGTCC
GTACGAGGCTTCGACCGCTACTTCTCCAGCCGCACGCTGGACAACAACCGGCGCAACATC
TGGTTTGCCGAGTTCTGGGAGGACAACTTCCACTGCAAGCTGAGCCGCCACGCCCTCAAG
AAGGGCAGCCACGTCAAGAAGTGCACCAACCGTGAGCGAATTGGGCAGGATTCAGCTTAT
GAGCAGGAGGGGAAGGTGCAGTTTGTGATCGATGCCGTGTACGCCATGGGCCACGCGCTG
CACGCCATGCACCGTGACCTGTGTCCCGGCCGCGTGGGGCTCTGCCCGCGCATGGACCCT
GTAGATGGCACCCAGCTGCTTAAGTACATCCGAAACGTCAACTTCTCAGGCATCGCAGGG
AACCCTGTGACCTTCAATGAGAATGGAGATGCGCCTGGGCGCTATGACATCTACCAATAC
CAGCTGCGCAACGATTCTGCCGAGTACAAGGTCATTGGCTCCTGGACTGACCACCTGCAC
CTTAGAATAGAGCGGATGCACTGGCCGGGGAGCGGGCAGCAGCTGCCCCGCTCCATCTGC
AGCCTGCCCTGCCAACCGGGTGAGCGGAAGAAGACAGTGAAGGGCATGCCTTGCTGCTGG
CACTGCGAGCCTTGCACAGGGTACCAGTACCAGGTGGACCGCTACACCTGTAAGACGTGT
CCCTATGACATGCGGCCCACAGAGAACCGCACGGGCTGCCGGCCCATCCCCATCATCAAG
CTTGAGTGGGGCTCGCCCTGGGCCGTGCTGCCCCTCTTCCTGGCCGTGGTGGGCATCGCT
GCCACGTTGTTCGTGGTGATCACCTTTGTGCGCTACAACGACACGCCCATCGTCAAGGCC
TCGGGCCGTGAACTGAGCTACGTGCTGCTGGCAGGCATCTTCCTGTGCTATGCCACCACC
TTCCTCATGATCGCTGAGCCCGACCTTGGCACCTGCTCGCTGCGCCGAATCTTCCTGGGA
CTAGGGATGAGCATCAGCTATGCAGCCCTGCTCACCAAGACCAACCGCATCTACCGCATC
TTCGAGCAGGGCAAGCGCTCGGTCAGTGCCCCACGCTTCATCAGCCCCGCCTCACAGCTG
GCCATCACCTTCAGCCTCATCTCGCTGCAGCTGCTGGGCATCTGTGTGTGGTTTGTGGTG
GACCCCTCCCACTCGGTGGTGGACTTCCAGGACCAGCGGACACTCGACCCCCGCTTCGCC
AGGGGTGTGCTCAAGTGTGACATCTCGGACCTGTCGCTCATCTGCCTGCTGGGCTACAGC
ATGCTGCTCATGGTCACGTGCACCGTGTATGCCATCAAGACACGCGGCGTGCCCGAGACC
TTCAATGAGGCCAAGCCCATTGGCTTCACCATGTACACCACTTGCATCGTCTGGCTGGCC
TTCATCCCCATCTTCTTTGGCACCTCGCAGTCGGCCGACAAGCTGTACATCCAGACGACG
ACGCTGACGGTCTCGGTGAGTCTGAGCGCCTCGGTGTCCCTGGGAATGCTCTACATGCCC
AAAGTCTACATCATCCTCTTCCACCCGGAGCAGAACGTGCCCAAGCGCAAGCGCAGCCTC
AAAGCCGTCGTTACGGCGGCCACCATGTCCAACAAGTTCACGCAGAAGGGCAACTTCCGG
CCCAACGGAGAGGCCAAGTCTGAGCTCTGCGAGAACCTTGAGGCCCCAGCGCTGGCCACC
AAACAGACTTACGTCACTTACACCAACCATGCAATCTAG
Protein Properties
Number of Residues 912
Molecular Weight 101866.8
Theoretical pI 8.98
Pfam Domain Function
Signals
  • 1-32
Transmembrane Regions
  • 588-610
  • 625-645
  • 657-675
  • 700-720
  • 751-772
  • 786-808
  • 822-847
Protein Sequence
>Metabotropic glutamate receptor 4
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
GenBank ID Protein 1160183
UniProtKB/Swiss-Prot ID Q14833
UniProtKB/Swiss-Prot Entry Name GRM4_HUMAN
PDB IDs Not Available
GenBank Gene ID X80818
GeneCard ID GRM4
GenAtlas ID GRM4
HGNC ID HGNC:4596
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. [PubMed:9473604 ]
  3. Makoff A, Lelchuk R, Oxer M, Harrington K, Emson P: Molecular characterization and localization of human metabotropic glutamate receptor type 4. Brain Res Mol Brain Res. 1996 Apr;37(1-2):239-48. [PubMed:8738157 ]
  4. Flor PJ, Lukic S, Ruegg D, Leonhardt T, Knopfel T, Kuhn R: Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4. Neuropharmacology. 1995 Feb;34(2):149-55. [PubMed:7617140 ]
  5. Ohtsuki T, Toru M, Arinami T: Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia. Psychiatr Genet. 2001 Jun;11(2):79-83. [PubMed:11525421 ]