You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10862
Secondary Accession Numbers
  • 17153
Name Metabotropic glutamate receptor 7
Synonyms
  1. mGluR7
Gene Name GRM7
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p26.1-p25.1
SNPs GRM7
Gene Sequence
>2748 bp
ATGGTCCAGCTGAGGAAGCTGCTCCGCGTCCTGACTTTGATGAAGTTCCCCTGCTGCGTG
CTGGAGGTGCTCCTGTGCGCGCTGGCGGCGGCGGCGCGCGGCCAGGAGATGTACGCCCCG
CACTCAATCCGGATCGAGGGGGACGTCACCCTCGGGGGGCTGTTCCCCGTGCACGCCAAG
GGTCCCAGCGGAGTGCCCTGCGGCGACATCAAGAGGGAAAACGGGATCCACAGGCTGGAA
GCGATGCTCTACGCCCTGGACCAGATCAACAGTGATCCCAACCTACTGCCCAACGTGACG
CTGGGCGCGCGGATCCTGGACACTTGTTCCAGGGACACTTACGCGCTCGAACAGTCGCTT
ACTTTCGTCCAGGCGCTCATCCAGAAGGACACCTCCGACGTGCGCTGCACCAACGGCGAA
CCGCCGGTTTTCGTCAAGCCGGAGAAAGTAGTTGGAGTGATTGGGGCTTCGGGGAGTTCG
GTCTCCATCATGGTAGCCAACATCCTGAGGCTCTTCCAGATCCCCCAGATTAGTTATGCA
TCAACGGCACCCGAGCTAAGTGATGACCGGCGCTATGACTTCTTCTCTCGCGTGGTGCCA
CCCGATTCCTTCCAAGCCCAGGCCATGGTAGACATTGTAAAGGCCCTAGGCTGGAATTAT
GTGTCTACCCTCGCATCGGAAGGAAGTTATGGAGAGAAAGGTGTGGAGTCCTTCACGCAG
ATTTCCAAAGAGGCAGGTGGACTCTGCATTGCCCAGTCCGTGAGAATCCCCCAGGAACGC
AAAGACAGGACCATTGACTTTGATAGAATTATCAAACAGCTCCTGGACACCCCCAACTCC
AGGGCCGTCGTGATTTTTGCCAACGATGAGGATATAAAGCAGATCCTTGCAGCAGCCAAA
AGAGCTGACCAAGTTGGCCATTTTCTTTGGGTGGGATCAGACAGCTGGGGATCCAAAATA
AACCCACTGCACCAGCATGAAGATATCGCAGAAGGGGCCATCACCATTCAGCCCAAGCGA
GCCACGGTGGAAGGGTTTGATGCCTACTTTACGTCCCGTACACTTGAAAACAACAGAAGA
AATGTATGGTTTGCCGAATACTGGGAGGAAAACTTCAACTGCAAGTTGACGATTAGTGGG
TCAAAAAAAGAAGACACAGATCGCAAATGCACAGGACAGGAGAGAATTGGAAAAGATTCC
AACTATGAGCAGGAGGGTAAAGTCCAGTTCGTGATTGACGCAGTCTATGCTATGGCTCAC
GCCCTTCACCACATGAACAAGGATCTCTGTGCTGACTACCGGGGTGTCTGCCCAGAGATG
GAGCAAGCTGGAGGCAAGAAGTTGCTGAAGTATATACGCAATGTTAATTTCAATGGTAGT
GCTGGCACTCCAGTGATGTTTAACAAGAACGGGGATGCACCTGGGCGTTATGACATCTTT
CAGTACCAGACCACAAACACCAGCAACCCGGGTTACCGTCTGATCGGGCAGTGGACAGAC
GAACTTCAGCTCAATATAGAAGACATGCAGTGGGGTAAAGGAGTCCGAGAGATACCCGCC
TCAGTGTGCACACTACCATGTAAGCCAGGACAGAGAAAGAAGACACAGAAAGGAACTCCT
TGCTGTTGGACCTGTGAGCCTTGCGATGGTTACCAGTACCAGTTTGATGAGATGACATGC
CAGCATTGCCCCTATGACCAGAGGCCCAATGAAAATCGAACCGGATGCCAGGATATTCCC
ATCATCAAACTGGAGTGGCACTCCCCCTGGGCTGTGATTCCTGTCTTCCTGGCAATGTTG
GGGATCATTGCCACCATCTTTGTCATGGCCACTTTCATCCGCTACAATGACACGCCCATT
GTCCGGGCATCTGGGCGGGAACTCAGCTATGTTCTTTTGACGGGCATCTTTCTTTGCTAC
ATCATCACTTTCCTGATGATTGCCAAACCAGATGTGGCAGTGTGTTCTTTCCGGCGAGTT
TTCTTGGGCTTGGGTATGTGCATCAGTTATGCAGCCCTCTTGACGAAAACAAATCGGATT
TATCGCATATTTGAGCAGGGCAAGAAATCAGTAACAGCTCCCAGACTCATAAGCCCAACA
TCACAACTGGCAATCACTTCCAGTTTAATATCAGTTCAGCTTCTAGGGGTGTTCATTTGG
TTTGGTGTTGATCCACCCAACATCATCATAGACTACGATGAACACAAGACAATGAACCCT
GAGCAAGCCAGAGGGGTTCTCAAGTGTGACATTACAGATCTCCAAATCATTTGCTCCTTG
GGATATAGCATTCTTCTCATGGTCACATGTACTGTGTATGCCATCAAGACTCGGGGTGTA
CCCGAGAATTTTAACGAAGCCAAGCCCATTGGATTCACTATGTACACGACATGTATAGTA
TGGCTTGCCTTCATTCCAATTTTTTTTGGCACCGCTCAATCAGCGGAAAAGCTCTACATA
CAAACTACCACGCTTACAATCTCCATGAACCTAAGTGCATCAGTGGCGCTGGGGATGCTA
TACATGCCGAAAGTGTACATCATCATTTTCCACCCTGAACTCAATGTCCAGAAACGGAAG
CGAAGCTTCAAGGCGGTAGTCACAGCAGCCACCATGTCATCGAGGCTGTCACACAAACCC
AGTGACAGACCCAACGGTGAGGCAAAGACCGAGCTCTGTGAAAACGTAGACCCAAACAGC
CCTGCTGCAAAAAAGAAGTATGTCAGTTATAATAACCTGGTTATCTAA
Protein Properties
Number of Residues 915
Molecular Weight 102250.1
Theoretical pI 7.94
Pfam Domain Function
Signals
  • 1-34
Transmembrane Regions
  • 591-615
  • 628-648
  • 655-675
  • 703-723
  • 754-775
  • 789-810
  • 826-850
Protein Sequence
>Metabotropic glutamate receptor 7
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
GenBank ID Protein 1370111
UniProtKB/Swiss-Prot ID Q14831
UniProtKB/Swiss-Prot Entry Name GRM7_HUMAN
PDB IDs Not Available
GenBank Gene ID X94552
GeneCard ID GRM7
GenAtlas ID GRM7
HGNC ID HGNC:4599
References
General References
  1. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. [PubMed:9473604 ]
  2. Makoff A, Pilling C, Harrington K, Emson P: Human metabotropic glutamate receptor type 7: molecular cloning and mRNA distribution in the CNS. Brain Res Mol Brain Res. 1996 Aug;40(1):165-70. [PubMed:8840028 ]
  3. Flor PJ, Van Der Putten H, Ruegg D, Lukic S, Leonhardt T, Bence M, Sansig G, Knopfel T, Kuhn R: A novel splice variant of a metabotropic glutamate receptor, human mGluR7b. Neuropharmacology. 1997 Feb;36(2):153-9. [PubMed:9144652 ]
  4. Schulz HL, Stohr H, Weber BH: Characterization of three novel isoforms of the metabotrobic glutamate receptor 7 (GRM7). Neurosci Lett. 2002 Jun 21;326(1):37-40. [PubMed:12052533 ]
  5. Bolonna AA, Kerwin RW, Munro J, Arranz MJ, Makoff AJ: Polymorphisms in the genes for mGluR types 7 and 8: association studies with schizophrenia. Schizophr Res. 2001 Jan 15;47(1):99-103. [PubMed:11163549 ]