Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10863
Secondary Accession Numbers
  • 17154
Name tRNA-specific adenosine deaminase 1
Synonyms
  1. hADAT1
  2. tRNA-specific adenosine-37 deaminase
Gene Name ADAT1
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function Specifically deaminates adenosine-37 to inosine in tRNA-Ala.
Pathways Not Available
Reactions
tRNA(Ala) adenine + Water → tRNA(Ala) hypoxanthine + Ammonia details
GO Classification
Biological Process
tRNA processing
Function
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
adenosine deaminase activity
nucleic acid binding
rna binding
Molecular Function
metal ion binding
RNA binding
tRNA-specific adenosine deaminase activity
Process
rna metabolic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
rna processing
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ADAT1
Gene Sequence
>1509 bp
ATGTGGACCGCGGATGAGATTGCTCAGCTATGCTATGAACACTATGGGATCAGGCTGCCC
AAGAAGGGGAAGCCTGAGCCAAACCATGAGTGGACATTATTGGCAGCGGTGGTGAAGATA
CAATCTCCAGCTGACAAGGCCTGCGACACCCCTGATAAGCCGGTGCAAGTGACAAAGGAA
ATTGTGTCAATGGGAACAGGAACAAAATGCATAGGACAGTCCAAAATGAGGAAGAACGGA
GACATCCTCAATGATAGCCATGCTGAGGTCATAGCCAGAAGGAGTTTCCAAAGGTACCTT
CTCCACCAACTCCAGTTGGCAGCCACCCTGAAAGAGGATAGCATCTTTGTCCCAGGAACT
CAAAAAGGAGTGTGGAAACTTAGACGAGACCTCATTTTTGTGTTTTTCTCCAGCCATACA
CCCTGTGGGGATGCCTCCATCATTCCGATGCTTGAGTTTGAAGATCAGCCTTGCTGTCCT
GTCTTCAGAAATTGGGCCAACAACTCATCAGTAGAAGCCAGTAGTAACCTGGAAGCTCCT
GGAAATGAAAGAAAATGTGAAGACCCTGACAGTCCTGTAACCAAAAAGATGAGGCTTGAG
CCTGGGACTGCAGCCAGGGAGGTCACCAACGGAGCAGCTCACCATCAGAGTTTTGGCAAG
CAGAAAAGTGGCCCAATCTCACCAGGCATCCACAGCTGTGATCTCACTGTAGAGGGACTG
GCTACTGTCACCAGAATAGCCCCTGGTAGTGCCAAAGTGACAGACGTTTATAGAACTGGA
GCCAAGTGTGTACCTGGAGAAGCTGGAGACTCCGGAAAGCCGGGTGCTGCGTTTCACCAG
GTGGGGCTGCTCCGAGTGAAGCCAGGCCGTGGAGACAGAACACGCTCCATGTCCTGTAGT
GACAAGATGGCCCGATGGAACGTCCTCGGATGCCAAGGGGCACTGTTGATGCACTTGCTG
GAAGAGCCCATCTACCTGTCAGCTGTGGTCATTGGGAAGTGCCCATACAGCCAGGAAGCC
ATGCAGAGAGCACTGATTGGAAGGTGTCAGAATGTGTCTGCTTTACCAAAAGGCTTCGGA
GTTCAAGAATTAAAAATACTGCAGTCAGATTTACTATTTGAACAGAGCCGCAGTGCGGTG
CAGGCAAAAAGGGCTGATAGCCCAGGTCGACTTGTTCCTTGTGGGGCAGCCATCAGCTGG
AGTGCAGTTCCTGAGCAGCCTTTGGATGTTACTGCCAATGGCTTTCCACAGGGAACAACA
AAGAAAACAATTGGAAGCCTTCAGGCAAGATCCCAAATCAGCAAAGTGGAACTCTTCAGA
TCATTCCAGAAGCTGCTAAGCAGAATTGCAAGGGACAAGTGGCCACACTCCCTCAGGGTG
CAGAAGCTGGATACCTACCAGGAGTACAAGGAGGCTGCGTCCTCTTACCAGGAAGCCTGG
AGCACACTCCGGAAGCAGGTGTTTGGATCCTGGATCAGAAACCCACCGGATTATCACCAG
TTCAAGTGA
Protein Properties
Number of Residues 502
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA-specific adenosine deaminase 1
MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKE
VVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGT
QKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAP
GNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGL
ATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS
DKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFG
VQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTT
KKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAW
STLRKQVFGSWIRNPPDYHQFK
GenBank ID Protein 5726241
UniProtKB/Swiss-Prot ID Q9BUB4
UniProtKB/Swiss-Prot Entry Name ADAT1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF125188
GeneCard ID ADAT1
GenAtlas ID ADAT1
HGNC ID HGNC:228
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Maas S, Gerber AP, Rich A: Identification and characterization of a human tRNA-specific adenosine deaminase related to the ADAR family of pre-mRNA editing enzymes. Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8895-900. [PubMed:10430867 ]