Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10864
Secondary Accession Numbers
  • 17155
Name Transient receptor potential cation channel subfamily A member 1
Synonyms
  1. Ankyrin-like with transmembrane domains protein 1
  2. Transformation-sensitive protein p120
Gene Name TRPA1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)- tetrahydrocannabinol (THC), the psychoactive component of marijuana. Not involved in menthol sensation. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:8
Locus 8q13
SNPs TRPA1
Gene Sequence
>3360 bp
ATGAAGTGCAGCCTGAGGAAGATGTGGCGCCCTGGAGAAAAGAAGGAGCCCCAGGGCGTT
GTCTATGAGGATGTGCCGGACGACACGGAGGATTTCAAGGAATCGCTTAAGGTGGTTTTT
GAAGGAAGTGCATATGGATTACAAAACTTTAATAAGCAAAAGAAATTAAAAACATGTGAC
GATATGGACACCTTCTTCTTGCATTATGCTGCAGCAGAAGGCCAAATTGAGCTAATGGAG
AAGATCACCAGAGATTCCTCTTTGGAAGTGCTGCATGAAATGGATGATTATGGAAATACC
CCTCTGCATTGTGCTGTAGAAAAAAACCAAATTGAAAGCGTTAAGTTTCTTCTCAGCAGA
GGAGCAAACCCAAACCTCCGAAACTTCAACATGATGGCTCCTCTCCACATAGCTGTGCAG
GGCATGAATAATGAGGTGATGAAGGTCTTGCTTGAGCATAGAACTATTGATGTTAATTTG
GAAGGAGAAAATGGAAACACAGCTGTGATCATTGCGTGCACCACAAATAATAGCGAAGCA
TTGCAGATTTTGCTTAACAAAGGAGCTAAGCCATGTAAATCAAATAAATGGGGATGTTTC
CCTATTCACCAAGCTGCATTTTCAGGTTCCAAAGAATGCATGGAAATAATACTAAGGTTT
GGTGAAGAGCATGGGTACAGTAGACAGTTGCACATTAACTTTATGAATAATGGGAAAGCC
ACCCCTCTCCACCTGGCTGTGCAAAATGGTGACTTGGAAATGATCAAAATGTGCCTGGAC
AATGGTGCACAAATAGACCCAGTGGAGAAGGGAAGGTGCACAGCCATTCATTTTGCTGCC
ACCCAGGGAGCCACTGAGATTGTTAAACTGATGATATCGTCCTATTCTGGTAGCGTGGAT
ATTGTTAACACAACCGATGGATGTCATGAGACCATGCTTCACAGAGCTTCATTGTTTGAT
CACCATGAGCTAGCAGACTATTTAATTTCAGTGGGAGCAGATATTAATAAGATCGATTCT
GAAGGACGCTCTCCACTTATATTAGCAACTGCTTCTGCATCTTGGAATATTGTAAATTTG
CTACTCTCTAAAGGTGCCCAAGTAGACATAAAAGATAATTTTGGACGTAATTTTCTGCAT
TTAACTGTACAGCAACCTTATGGATTAAAAAATCTGCGACCTGAATTTATGCAGATGCAA
CAGATCAAAGAGCTGGTAATGGATGAAGACAACGATGGGTGTACTCCTCTACATTATGCA
TGTAGACAGGGGGGCCCTGGTTCTGTAAATAACCTACTTGGCTTTAATGTGTCCATTCAT
TCCAAAAGCAAAGATAAGAAATCACCTCTGCATTTTGCAGCCAGTTATGGGCGTATCAAT
ACCTGTCAGAGGCTCCTACAAGACATAAGTGATACGAGGCTTCTGAATGAAGGTGACCTT
CATGGAATGACTCCTCTCCATCTGGCAGCAAAGAATGGACATGATAAAGTAGTTCAGCTT
CTTCTGAAAAAAGGTGCATTGTTTCTCAGTGACCACAATGGCTGGACAGCTTTGCATCAT
GCGTCCATGGGCGGGTACACTCAGACCATGAAGGTCATTCTTGATACTAATTTGAAGTGC
ACAGATCGCTTGGATGAAGACGGGAACACTGCACTTCACTTTGCTGCAAGGGAAGGCCAC
GCCAAAGCCGTTGCGCTTCTTCTGAGCCACAATGCTGACATAGTCCTGAACAAGCAGCAG
GCCTCCTTTTTGCACCTTGCACTTCACAATAAGAGGAAGGAGGTTGTTCTTACGATCATC
AGGAGCAAAAGATGGGATGAATGTCTTAAGATTTTCAGTCATAATTCTCCAGGCAATAAA
TGTCCAATTACAGAAATGATAGAATACCTCCCTGAATGCATGAAGGTACTTTTAGATTTC
TGCATGTTGCATTCCACAGAAGACAAGTCCTGCCGAGACTATTATATCGAGTATAATTTC
AAATATCTTCAATGTCCATTAGAATTCACCAAAAAAACACCTACACAGGATGTTATATAT
GAACCGCTTACAGCCCTCAACGCAATGGTACAAAATAACCGCATAGAGCTTCTCAATCAT
CCTGTGTGTAAAGAATATTTACTCATGAAATGGTTGGCTTATGGATTTAGAGCTCATATG
ATGAATTTAGGATCTTACTGTCTTGGTCTCATACCTATGACCATTCTCGTTGTCAATATA
AAACCAGGAATGGCTTTCAACTCAACTGGCATCATCAATGAAACTAGTGATCATTCAGAA
ATACTAGATACCACGAATTCATATCTAATAAAAACTTGTATGATTTTAGTGTTTTTATCA
AGTATATTTGGGTATTGCAAAGAAGCGGGGCAAATTTTCCAACAGAAAAGGAATTATTTT
ATGGATATAAGCAATGTTCTTGAATGGATTATCTACACGACGGGCATCATTTTTGTGCTG
CCCTTGTTTGTTGAAATACCAGCTCATCTGCAGTGGCAATGTGGAGCAATTGCTGTTTAC
TTCTATTGGATGAATTTCTTATTGTATCTTCAAAGATTTGAAAATTGTGGAATTTTTATT
GTTATGTTGGAGGTAATTTTGAAAACTTTGTTGAGGTCTACAGTTGTATTTATCTTCCTT
CTTCTGGCTTTTGGACTCAGCTTTTACATCCTCCTGAATTTACAGGATCCCTTCAGCTCT
CCATTGCTTTCTATAATCCAGACCTTCAGCATGATGCTAGGAGATATCAATTATCGAGAG
TCCTTCCTAGAACCATATCTGAGAAATGAATTGGCACATCCAGTTCTGTCCTTTGCACAA
CTTGTTTCCTTCACAATATTTGTCCCAATTGTCCTCATGAATTTACTTATTGGTTTGGCA
GTTGGCGACATTGCTGAGGTCCAGAAACATGCATCATTGAAGAGGATAGCTATGCAGGTG
GAACTTCATACCAGCTTAGAGAAGAAGCTGCCACTTTGGTTTCTACGCAAAGTGGATCAG
AAATCCACCATCGTGTATCCCAACAAACCCAGATCTGGTGGGATGTTATTCCATATATTC
TGTTTTTTATTTTGCACTGGGGAAATAAGACAAGAAATACCAAATGCTGATAAATCTTTA
GAAATGGAAATATTAAAGCAGAAATACCGGCTGAAGGATCTTACTTTTCTCCTGGAAAAA
CAGCATGAGCTCATTAAACTGATCATTCAGAAGATGGAGATCATCTCTGAGACAGAGGAT
GATGATAGCCATTGTTCTTTTCAAGACAGGTTTAAGAAAGAGCAGATGGAACAAAGGAAT
AGCAGATGGAATACTGTGTTGAGAGCAGTCAAGGCAAAAACACACCATCTTGAGCCTTAG
Protein Properties
Number of Residues 1119
Molecular Weight 127485.8
Theoretical pI 7.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 720-740
  • 773-793
  • 806-826
  • 830-850
  • 874-894
  • 941-961
Protein Sequence
>Transient receptor potential cation channel subfamily A member 1
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLNKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
GenBank ID Protein 3287188
UniProtKB/Swiss-Prot ID O75762
UniProtKB/Swiss-Prot Entry Name TRPA1_HUMAN
PDB IDs Not Available
GenBank Gene ID Y10601
GeneCard ID TRPA1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  2. Jaquemar D, Schenker T, Trueb B: An ankyrin-like protein with transmembrane domains is specifically lost after oncogenic transformation of human fibroblasts. J Biol Chem. 1999 Mar 12;274(11):7325-33. [PubMed:10066796 ]