You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10865
Secondary Accession Numbers
  • 17156
Name Nuclear receptor corepressor 2
Synonyms
  1. CTG repeat protein 26
  2. N-CoR2
  3. SMAP270
  4. SMRT
  5. Silencing mediator of retinoic acid and thyroid hormone receptor
  6. T3 receptor-associating factor
  7. TRAC
  8. Thyroid-, retinoic-acid-receptor-associated corepressor
Gene Name NCOR2
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription. Isoform 1 and isoform 5 have different affinities for different nuclear receptors
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleic acid binding
dna binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24
SNPs NCOR2
Gene Sequence
>7575 bp
ATGTCGGGATCCACACAGCCTGTGGCACAGACGTGGAGGGCCACTGAGCCCCGCTACCCG
CCCCACAGCCTTTCCTACCCAGTGCAGATCGCCCGGACGCACACGGACGTCGGGCTCCTG
GAGTACCAGCACCACTCCCGCGACTATGCCTCCCACCTGTCGCCCGGCTCCATCATCCAG
CCCCAGCGGCGGAGGCCCTCCCTGCTGTCTGAGTTCCAGCCCGGGAATGAACGGTCCCAG
GAGCTCCACCTGCGGCCAGAGTCCCACTCATACCTGCCCGAGCTGGGGAAGTCAGAGATG
GAGTTCATTGAAAGCAAGCGCCCTCGGCTAGAGCTGCTGCCTGACCCCCTGCTGCGACCG
TCACCCCTGCTGGCCACGGGCCAGCCTGCGGGATCTGAAGACCTCACCAAGGACCGTAGC
CTGACGGGCAAGCTGGAACCGGTGTCTCCCCCCAGCCCCCCGCACACTGACCCTGAGCTG
GAGCTGGTGCCGCCACGGCTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGAC
CGAGAGATCACCATGGTAGAGCAGCAGATCTCTAAGCTGAAGAAGAAGCAGCAACAGCTG
GAGGAGGAGGCTGCCAAGCCGCCCGAGCCTGAGAAGCCCGTGTCACCGCCGCCCATCGAG
TCGAAGCACCGCAGCCTGGTGCAGATCATCTACGACGAGAACCGGAAGAAGGCTGAAGCT
GCACATCGGATTCTGGAAGGCCTGGGGCCCCAGGTGGAGCTGCCGCTGTACAACCAGCCC
TCCGACACCCGGCAGTATCATGAGAACATCAAAATAAACCAGGCGATGCGGAAGAAGCTA
ATCTTGTACTTCAAGAGGAGGAATCACGCTCGGAAACAATGGGAGCAGAAGTTCTGCCAG
CGCTATGACCAGCTCATGGAGGCCTGGGAGAAGAAGGTGGAGCGCATCGAGAACAACCCC
CGGCGGCGGGCCAAGGAGAGCAAGGTGCGCGAGTACTACGAGAAGCAGTTCCCTGAGATC
CGCAAGCAGCGCGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGGGGCAGTGGG
CTGTCCATGTCGGCCGCCCGCAGCGAGCACGAGGTGTCAGAGATCATCGATGGCCTCTCA
GAGCAGGAGAACCTGGAGAAGCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGCTGTAC
GACGCTGACCAGCAGCGCATCAAGTTCATCAACATGAACGGGCTTATGGCCGACCCCATG
AAGGTGTACAAAGACCGCCAGGTCATGAACATGTGGAGTGAGCAGGAGAAGGAGACCTTC
CGGGAGAAGTTCATGCAGCATCCCAAGAACTTTGGCCTGATCGCATCATTCCTGGAGAGG
AAGACAGTGGCTGAGTGCGTCCTCTATTACTACCTGACTAAGAAGAATGAGAACTATAAG
AGCCTGGTGAGACGGAGCTATCGGCGCCGCGGCAAGAGCCAGCAGCAGCAACAACAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCATGCCCCGCAGCAGCCAGGAGGAGAAA
GATGAGAAGGAGAAGGAAAAGGAGGCGGAGAAGGAGGAGGAGAAGCCGGAGGTGGAGAAC
GACAAGGAAGACCTCCTCAAGGAGAAGACAGACGACACCTCAGGGGAGGACAACGACGAG
AAGGAGGCTGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAGGGAAGACGCAAAGGC
CGCATCACCCGCTCAATGGCTAATGAGGCCAACAGCGAGGAGGCCATCACCCCCCAGCAG
AGCGCCGAGCTGGCCTCCATGGAGCTGAATGAGAGTTCTCGCTGGACAGAAGAAGAAATG
GAAACAGCCAAGAAAGGTCTCCTGGAACACGGCCGCAACTGGTCGGCCATCGCCCGGATG
GTGGGCTCCAAGACTGTGTCGCAGTGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAG
AACCTCGATGAGATCTTGCAGCAGCACAAGCTGAAGATGGAGAAGGAGAGGAACGCGCGG
AGGAAGAAGAAGAAAGCGCCGGCGGCGGCCAGCGAGGAGGCTGCATTCCCGCCCGTGGTG
GAGGATGAGGAGATGGAGGCGTCGGGCGTGAGCGGAAATGAGGAGGAGATGGTGGAGGAG
GCTGAAGCCTTACATGCCTCTGGGAATGAGGTGCCCAGAGGGGAATGCAGTGGCCCAGCC
ACTGTCAACAACAGCTCAGACACCGAGAGCATCCCCTCTCCTCACACTGAGGCCGCCAAG
GACACAGGGCAGAATGGGCCCAAGCCCCCAGCCACCCTGGGCGCCGACGGGCCACCCCCA
GGGCCACCCACCCCACCACCGGAGGACATCCCGGCCCCCACTGAGCCCACCCCGGCCTCT
GAAGCCACCGGAGCCCCTACGCCCCCACCAGCACCCCCATCGCCCTCTGCACCTCCTCCT
GTGGTCCCCAAGGAGGAGAAGGAGGAGGAGACCGCAGCAGCGCCCCCAGTGGAGGAGGGG
GAGGAGCAGAAGCCCCCCGCGGCTGAGGAGCTGGCAGTGGACACAGGGAAGGCCGAGGAG
CCCGTCAAGAGCGAGTGCACGGAGGAAGCCGAGGAGGGGCCGGCCAAGGGCAAGGACGCG
GAGGCCGCTGAGGCCACGGCCGAGGGGGCGCTCAAGGCAGAGAAGAAGGAGGGCGGGAGC
GGCAGGGCCACCACAGCCAAGAGCTCGGGCGCCCCCCAGGACAGCGACTCCAGTGCTACC
TGCAGTGCAGACGAGGTGGATGAGGCCGAGGGCGGCGACAAGAACCGGCTGCTGTCCCCA
AGGCCCAGCCTCCTCACCCCGACTGGCGACCCCCGGGCCAATGCCTCACCCCAGAAGCCA
CTGGACCTGAAGCAGCTGAAGCAGCGAGCGGCTGCCATCCCCCCCATCGTCACCAAAGTC
CATGAGCCCCCCCGGGAGGACGCAGCTCCCACCAAGCCAGCTCCCCCAGCCCCACCGCCA
CCGCAAAACCTGCAGCCGGAGAGCGACGCCCCTCAGCAGCCTGGCAGCAGCCCCCGGGGC
AAGAGCAGGAGCCCGGCACCCCCCGCCGACAAGGAGGCAGAGAAGCCTGTGTTCTTCCCA
GCCTTCGCAGCCGAGGCCCAGAAGCTGCCTGGGGACCCCCCTTGCTGGACTTCCGGCCTG
CCCTTCCCCGTGCCCCCCCGTGAGGTGATCAAGGCCTCCCCGCATGCCCCGGACCCCTCA
GCCTTCTCCTACGCTCCACCTGGTCACCCACTGCCCCTGGGCCTCCATGACACTGCCCGG
CCCGTCCTGCCGCGCCCACCCACCATCTCCAACCCGCCTCCCCTCATCTCCTCTGCCAAG
CACCCCAGCGTCCTCGAGAGGCAAATAGGTGCCATCTCCCAAGGAATGTCGGTCCAGCTC
CACGTCCCGTACTCAGAGCATGCCAAGGCCCCGGTGGGCCCTGTCACCATGGGGCTGCCC
CTGCCCATGGACCCCAAAAAGCTGGCACCCTTCAGCGGAGTGAAGCAGGAGCAGCTGTCC
CCACGGGGCCAGGCTGGGCCACCGGAGAGCCTGGGGGTGCCCACAGCCCAGGAGGCGTCC
GTGCTGAGAGGGACAGCTCTGGGCTCAGTTCCGGGCGGAAGCATCACCAAAGGCATTCCC
AGCACACGGGTGCCCTCGGACAGCGCCATCACATACCGCGGCTCCATCACCCACGGCACG
CCAGCTGACGTCCTGTACAAGGGCACCATCACCAGGATCATCGGCGAGGACAGCCCGAGT
CGCTTGGACCGCGGCCGGGAGGACAGCCTGCCCAAGGGCCACGTCATCTACGAAGGCAAG
AAGGGCCACGTCTTGTCCTATGAGGGTGGCATGTCTGTGACCCAGTGCTCCAAGGAGGAC
GGCAGAAGCAGCTCAGGACCCCCCCATGAGACGGCCGCCCCCAAGCGCACCTATGACATG
ATGGAGGGCCGCGTGGGCAGAGCCATCTCCTCAGCCAGCATCGAAGGTCTCATGGGCCGT
GCCATCCCGCCGGAGCGACACAGCCCCCACCACCTCAAAGAGCAGCACCACATCCGCGGG
TCCATCACACAAGGGATCCCTCGGTCCTACGTGGAGGCACAGGAGGACTACCTGCGTCGG
GAGGCCAAGCTCCTAAAGCGGGAGGGCACGCCTCCGCCCCCACCGCCCTCACGGGACCTG
ACCGAGGCCTACAAGACGCAGGCCCTGGGCCCCCTGAAGCTGAAGCCGGCCCATGAGGGC
CTGGTGGCCACGGTGAAGGAGGCGGGCCGCTCCATCCATGAGATCCCGCGCGAGGAGCTG
CGGCACACGCCCGAGCTGCCCCTGGCCCCGCGGCCGCTCAAGGAGGGCTCCATCACGCAG
GGCACCCCGCTCAAGTACGACACCGGCGCGTCCACCACTGGCTCCAAAAAGCACGACGTA
CGCTCCCTCATCGGCAGCCCCGGCCGGACGTTCCCACCCGTGCACCCGCTGGATGTGATG
GCCGACGCCCGGGCACTGGAACGTGCCTGCTACGAGGAGAGCCTGAAGAGCCGGCCAGGG
ACCGCCAGCAGCTCGGGGGGCTCCATTGCGCGCGGCGCCCCGGTCATTGTGCCTGAGCTG
GGTAAGCCGCGGCAGAGCCCCCTGACCTATGAGGACCACGGGGCACCCTTTGCCGGCCAC
CTCCCACGAGGTTCGCCCGTGACCACGCGGGAGCCCACGCCGCGCCTGCAGGAGGGCAGC
CTTTCGTCCAGCAAGGCATCCCAGGACCGAAAGCTGACGTCGACGCCTCGTGAGATCGCC
AAGTCCCCGCACAGCACCGTGCCCGAGCACCACCCACACCCCATCTCGCCCTATGAGCAC
CTGCTTCGGGGCGTGAGTGGCGTGGACCTGTATCGCAGCCACATCCCCCTGGCCTTCGAC
CCCACCTCCATACCCCGCGGCATCCCTCTGGACGCAGCCGCTGCCTACTACCTGCCCCGA
CACCTGGCCCCCAACCCCACCTACCCGCACCTGTACCCACCCTACCTCATCCGCGGCTAC
CCCGACACGGCGGCGCTGGAGAACCGGCAGACCATCATCAATGACTACATCACCTCGCAG
CAGATGCACCACAACGCGGCCACCGCCATGGCCCAGCGAGCTGATATGCTGAGGGGCCTC
TCGCCCCGCGAGTCCTCGCTGGCACTCAACTACGCTGCGGGTCCCCGAGGCATCATCGAC
CTGTCCCAAGTGCCACACCTGCCTGTGCTCGTGCCCCCGACACCAGGCACCCCAGCCACC
GCCATGGACCGCCTTGCCTACCTCCCCACCGCGCCCCAGCCCTTCAGCAGCCGCCACAGC
AGCTCCCCACTCTCCCCAGGAGGTCCAACACACTTGACAAAACCAACCACCACGTCCTCG
TCCGAGCGGGAGCGAGACCGGGATCGAGAGCGGGACCGGGATCGGGAGCGGGAAAAGTCC
ATCCTCACGTCCACCACGACGGTGGAGCACGCACCCATCTGGAGACCTGGTACAGAGCAG
AGCAGCGGCAGCAGCGGCAGCAGCGGCGGGGGTGGGGGCAGCAGCAGCCGCCCCGCCTCC
CACTCCCATGCCCACCAGCACTCGCCCATCTCCCCTCGGACCCAGGATGCCCTCCAGCAG
AGACCCAGTGTGCTTCACAACACAGGCATGAAGGGTATCATCACCGCTGTGGAGCCCAGC
ACGCCCACGGTCCTGAGGTCCACCTCCACCTCCTCACCCGTTCGCCCGGCTGCCACATTC
CCACCTGCCACCCACTGCCCACTGGGCGGCACCCTCGATGGGGTCTACCCTACCCTCATG
GAGCCCGTCTTGCTGCCCAAGGAGGCCCCCCGGGTCGCCCGGCCAGAGCGGCCCCGAGCA
GACACCGGCCATGCCTTCCTCGCCAAGCCCCCAGCCCGCTCCGGGCTGGAGCCCGCCTCC
TCCCCCAGCAAGGGCTCGGAGCCCCGGCCCCTAGTGCCTCCTGTCTCTGGCCACGCCACC
ATCGCCCGCACCCCTGCGAAGAACCTCGCACCTCACCACGCCAGCCCGGACCCGCCGGCG
CCACCTGCCTCGGCCTCGGACCCGCACCGGGAAAAGACTCAAAGTAAACCCTTTTCCATC
CAGGAACTGGAACTCCGTTCTCTGGGTTACCACGGCAGCAGCTACAGCCCCGAAGGGGTG
GAGCCCGTCAGCCCTGTGAGCTCACCCAGTCTGACCCACGACAAGGGGCTCCCCAAGCAC
CTGGAAGAGCTCGACAAGAGCCACCTGGAGGGGGAGCTGCGGCCCAAGCAGCCAGGCCCC
GTGAAGCTTGGCGGGGAGGCCGCCCACCTCCCACACCTGCGGCCGCTGCCTGAGAGCCAG
CCCTCGTCCAGCCCGCTGCTCCAGACCGCCCCAGGGGTCAAAGGTCACCAGCGGGTGGTC
ACCCTGGCCCAGCACATCAGTGAGGTCATCACACAGGACTACACCCGGCACCACCCACAG
CAGCTCAGCGCACCCCTGCCCGCCCCCCTCTACTCCTTCCCTGGGGCCAGCTGCCCCGTC
CTGGACCTCCGCCGCCCACCCAGTGACCTCTACCTCCCGCCCCCGGACCATGGTGCCCCG
GCCCGTGGCTCCCCCCACAGCGAAGGGGGCAAGAGGTCTCCAGAGCCAAACAAGACGTCG
GTCTTGGGTGGTGGTGAGGACGGTATTGAACCTGTGTCCCCACCGGAGGGCATGACGGAG
CCAGGGCACTCCCGGAGTGCTGTGTACCCGCTGCTGTACCGGGATGGGGAACAGACGGAG
CCCAGCAGGATGGGCTCCAAGTCTCCAGGCAACACCAGCCAGCCGCCAGCCTTCTTCAGC
AAGCTGACCGAGAGCAACTCCGCCATGGTCAAGTCCAAGAAGCAAGAGATCAACAAGAAG
CTGAACACCCACAACCGGAATGAGCCTGAATACAATATCAGCCAGCCTGGGACGGAGATC
TTCAATATGCCCGCCATCACCGGAACAGGCCTTATGACCTATAGAAGCCAGGCGGTGCAG
GAACATGCCAGCACCAACATGGGGCTGGAGGCCATAATTAGAAAGGCACTCATGGGTAAA
TATGACCAGTGGGAAGAGTCCCCGCCGCTCAGCGCCAATGCTTTTAACCCTCTGAATGCC
AGTGCCAGCCTGCCCGCTGCTATGCCCATAACCGCTGCTGACGGACGGAGTGACCACACA
CTCACCTCGCCAGGTGGCGGCGGGAAGGCCAAGGTCTCTGGCAGACCCAGCAGCCGAAAA
GCCAAGTCCCCGGCCCCGGGCCTGGCATCTGGGGACCGGCCACCCTCTGTCTCCTCAGTG
CACTCGGAGGGAGACTGCAACCGCCGGACGCCGCTCACCAACCGCGTGTGGGAGGACAGG
CCCTCGTCCGCAGGTTCCACGCCATTCCCCTACAACCCCCTGATCATGCGGCTGCAGGCG
GGTGTCATGGCTTCCCCACCCCCACCGGGCCTCCCCGCGGGCAGCGGGCCCCTCGCTGGC
CCCCACCACGCCTGGGACGAGGAGCCCAAGCCACTGCTCTGCTCGCAGTACGAGACACTC
TCCGACAGCGAGTGA
Protein Properties
Number of Residues 2525
Molecular Weight 274801.7
Theoretical pI 7.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nuclear receptor corepressor 2
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQ
PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
SPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQ
NLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEE
AEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPP
GPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG
EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKP
LDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR
GKSRSPAPPADKEAEKPVFFPAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDP
SAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQ
LHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEA
SVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSP
SRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYD
MMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLR
REAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREE
LRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDV
MADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAG
HLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYE
HLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRG
YPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGII
DLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTS
SSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGSSGGGGGSSSRPA
SHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAAT
FPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPA
SSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFS
IQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPG
PVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHP
QQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKT
SVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFF
SKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAV
QEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDH
TLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWED
RPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYET
LSDSE
GenBank ID Protein 116256453
UniProtKB/Swiss-Prot ID Q9Y618
UniProtKB/Swiss-Prot Entry Name NCOR2_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID NCOR2
GenAtlas ID NCOR2
HGNC ID HGNC:7673
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Shi Y, Downes M, Xie W, Kao HY, Ordentlich P, Tsai CC, Hon M, Evans RM: Sharp, an inducible cofactor that integrates nuclear receptor repression and activation. Genes Dev. 2001 May 1;15(9):1140-51. [PubMed:11331609 ]
  11. Amann JM, Nip J, Strom DK, Lutterbach B, Harada H, Lenny N, Downing JR, Meyers S, Hiebert SW: ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain. Mol Cell Biol. 2001 Oct;21(19):6470-83. [PubMed:11533236 ]
  12. Fischer DD, Cai R, Bhatia U, Asselbergs FA, Song C, Terry R, Trogani N, Widmer R, Atadja P, Cohen D: Isolation and characterization of a novel class II histone deacetylase, HDAC10. J Biol Chem. 2002 Feb 22;277(8):6656-66. Epub 2001 Dec 5. [PubMed:11739383 ]
  13. Guenther MG, Lane WS, Fischle W, Verdin E, Lazar MA, Shiekhattar R: A core SMRT corepressor complex containing HDAC3 and TBL1, a WD40-repeat protein linked to deafness. Genes Dev. 2000 May 1;14(9):1048-57. [PubMed:10809664 ]
  14. Li J, Wang J, Wang J, Nawaz Z, Liu JM, Qin J, Wong J: Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3. EMBO J. 2000 Aug 15;19(16):4342-50. [PubMed:10944117 ]
  15. Zhang J, Kalkum M, Chait BT, Roeder RG: The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2. Mol Cell. 2002 Mar;9(3):611-23. [PubMed:11931768 ]
  16. Sande S, Privalsky ML: Identification of TRACs (T3 receptor-associating cofactors), a family of cofactors that associate with, and modulate the activity of, nuclear hormone receptors. Mol Endocrinol. 1996 Jul;10(7):813-25. [PubMed:8813722 ]
  17. Ordentlich P, Downes M, Xie W, Genin A, Spinner NB, Evans RM: Unique forms of human and mouse nuclear receptor corepressor SMRT. Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):2639-44. [PubMed:10077563 ]
  18. Park EJ, Schroen DJ, Yang M, Li H, Li L, Chen JD: SMRTe, a silencing mediator for retinoid and thyroid hormone receptors-extended isoform that is more related to the nuclear receptor corepressor. Proc Natl Acad Sci U S A. 1999 Mar 30;96(7):3519-24. [PubMed:10097068 ]
  19. Margolis RL, Abraham MR, Gatchell SB, Li SH, Kidwai AS, Breschel TS, Stine OC, Callahan C, McInnis MG, Ross CA: cDNAs with long CAG trinucleotide repeats from human brain. Hum Genet. 1997 Jul;100(1):114-22. [PubMed:9225980 ]
  20. Chen JD, Evans RM: A transcriptional co-repressor that interacts with nuclear hormone receptors. Nature. 1995 Oct 5;377(6548):454-7. [PubMed:7566127 ]
  21. Mizutani A, Wang L, Rajan H, Vig PJ, Alaynick WA, Thaler JP, Tsai CC: Boat, an AXH domain protein, suppresses the cytotoxicity of mutant ataxin-1. EMBO J. 2005 Sep 21;24(18):3339-51. Epub 2005 Aug 25. [PubMed:16121196 ]
  22. Goodson ML, Jonas BA, Privalsky ML: Alternative mRNA splicing of SMRT creates functional diversity by generating corepressor isoforms with different affinities for different nuclear receptors. J Biol Chem. 2005 Mar 4;280(9):7493-503. Epub 2005 Jan 4. [PubMed:15632172 ]
  23. Ahmad KF, Melnick A, Lax S, Bouchard D, Liu J, Kiang CL, Mayer S, Takahashi S, Licht JD, Prive GG: Mechanism of SMRT corepressor recruitment by the BCL6 BTB domain. Mol Cell. 2003 Dec;12(6):1551-64. [PubMed:14690607 ]