You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10866
Secondary Accession Numbers
  • 17159
Name CHIA protein
Synonyms Not Available
Gene Name CHIA
Protein Type Unknown
Biological Properties
General Function Involved in chitin binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
ion binding
cation binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
pattern binding
polysaccharide binding
chitinase activity
chitin binding
Process
polysaccharide metabolic process
aminoglycan metabolic process
metabolic process
primary metabolic process
carbohydrate metabolic process
polysaccharide catabolic process
aminoglycan catabolic process
chitin catabolic process
chitin metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.2
SNPs CHIA
Gene Sequence
>1225 bp
CAAAGCTTATTCTCCTCACAGGTCTTGTCCTTATACTGAATTTGCAGCTCGGAACAGCCA
GCTGAAAACTCTCCTGGCCATTGGAGGCTGGAACTTCGGGACTGCCCCTTTCACTGCCAT
GGTTTCTACTCCTGAGAACCGCCAGACTTTCATCACCTCAGTCATCAGATTCCTGCGCCA
GTATGAGTTTGACGGGCTGGACTTTGACTGGGAGTACCCTGGCTCTCGTGGGAGCCCTCC
TCAGGACAAGCATCTCTTCACTGTCCTGGTGCAGGAAATGCGTGAAGCTTTTGAGCAGGA
GGCCAAGCAGATCAACAAGCCCAGGCTGATGGTCACTGCTGCAGTAGCTGCTGGCATCTC
CAATATCCAGTCTGGCTATGAGATCCCCCAACTGTCACAGTACCTGGACTACATCCATGT
CATGACCTACGACCTCCATGGCTCCTGGGAGGGCTACACTGGAGAGAACAGCCCCCTCTA
CAAATACCCGACTGACACCGGCAGCAACGCCTACCTCAATGTGGATTATGTCATGAACTA
CTGGAAGGACAATGGAGCACCAGCTGAGAAGCTCATCGTTGGATTCCCTACCTATGGACA
CAACTTCATCCTGAGCAACCCCTCCAACACTGGAATTGGTGCCCCCACCTCTGGTGCTGG
TCCTGCTGGGCCCTATGCCAAGGAGTCTGGGATCTGGGCTTACTACGAGATCTGTACCTT
CCTGAAAAATGGAGCCACTCAGGGATGGGATGCCCCTCAGGAAGTGCCTTATGCCTATCA
GGGCAATGTGTGGGTTGGCTATGACAACGTCAAGAGCTTCGATATTAAGGCTCAATGGCT
TAAGCACAACAAATCTGGAGGCGCCATGGTCTGGGCCATTGATCTGGATGACTTCACTGG
CACTTTCTGCAACCAGGGCAAGTTTCCCCTAATCTCCACCCTGAAGAAGGCCCTCGGCCT
GCAGAGTGCAAGTTGCACGGCTCCAGCTCAGCCCATTGAGCCAATAACTGCTGCTCCCAG
TGGCAGCGGGAACGGGAGCGGGAGTAGCAGCTCTGGAGGCAGCTCGGGAGGCAGTGGATT
CTGTGCTGGCAGAGCCAACGGCCTCTACCCCGTGGCAAATAACAGAAATGCCTTCTGGCA
CTGCGTGAATGGAGTCACGTACCAGCAGAACTGCCAGGCCGGGCTTGTCTTCGACACCAG
CTGTGATTGCTGCAACTGGGCATAA
Protein Properties
Number of Residues 407
Molecular Weight 44306.1
Theoretical pI 5.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>CHIA protein
KAYSPHRSCPYTEFAARNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIRFLRQ
YEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGIS
NIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNY
WKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTF
LKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKSGGAMVWAIDLDDFTG
TFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGF
CAGRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
GenBank ID Protein 146218445
UniProtKB/Swiss-Prot ID A5D6V7
UniProtKB/Swiss-Prot Entry Name A5D6V7_HUMAN
PDB IDs Not Available
GenBank Gene ID BC139901
GeneCard ID CHIA
GenAtlas ID CHIA
HGNC ID HGNC:17432
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]