You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10868
Secondary Accession Numbers
  • 17161
Name Chitinase, acidic
Synonyms Not Available
Gene Name CHIA
Protein Type Unknown
Biological Properties
General Function Involved in chitin binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
ion binding
cation binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
pattern binding
polysaccharide binding
chitinase activity
chitin binding
Process
polysaccharide metabolic process
aminoglycan metabolic process
metabolic process
primary metabolic process
carbohydrate metabolic process
polysaccharide catabolic process
aminoglycan catabolic process
chitin catabolic process
chitin metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.2
SNPs CHIA
Gene Sequence
>1263 bp
GATAGTCAAAAACAATATTGGGGGAGAGAGAGGTAGGTGGGTGATAACCTCCAACCAGAG
CTTCCCAAGGAGATATCACTGTGTCCTTAGAACAGCCAGCTGAAAACTCTCCTGGCCATT
GGAGGCTGGAACTTCGGGACTGCCCCTTTCACTGCCATGGTTTCTACTCCTGAGAACCGC
CAGACTTTCATCACCTCAGTCATCAAATTCCTGCGCCAGTATGAGTTTGACGGGCTGGAC
TTTGACTGGGAGTACCCTGGCTCTCGTGGGAGCCCTCCTCAGGACAAGCATCTCTTCACT
GTCCTGGTGCAGGAAATGCGTGAAGCTTTTGAGCAGGAGGCCAAGCAGATCAACAAGCCC
AGGCTGATGGTCACTGCTGCAGTAGCTGCTGGCATCTCCAATATCCAGTCTGGCTATGAG
ATCCCCCAACTGTCACAGTACCTGGACTACATCCATGTCATGACCTACGACCTCCATGGC
TCCTGGGAGGGCTACACTGGAGAGAACAGCCCCCTCTACAAATACCCGACTGACACCGGC
AGCAACGCCTACCTCAATGTGGATTATGTCATGAACTACTGGAAGGACAATGGAGCACCA
GCTGAGAAGCTCATCGTTGGATTCCCTACCTATGGACACAACTTCATCCTGAGCAACCCC
TCCAACACTGGAATTGGTGCCCCCACCTCTGGTGCTGGTCCTGCTGGGCCCTATGCCAAG
GAGTCTGGGATCTGGGCTTACTACGAGATCTGTACCTTCCTGAAAAATGGAGCCACTCAG
GGATGGGATGCCCCTCAGGAAGTGCCTTATGCCTATCAGGGCAATGTGTGGGTTGGCTAT
GACAACATCAAGAGCTTCGATATTAAGGCTCAATGGCTTAAGCACAACAAATTTGGAGGC
GCCATGGTCTGGGCCATTGATCTGGATGACTTCACTGGCACTTTCTGCAACCAGGGCAAG
TTTCCCCTAATCTCCACCCTGAAGAAGGCCCTCGGCCTGCAGAGTGCAAGTTGCACGGCT
CCAGCTCAGCCCATTGAGCCAATAACTGCTGCTCCCAGTGGCAGCGGGAACGGGAGCGGG
AGTAGCAGCTCTGGAGGCAGCTCGGGAGGCAGTGGATTCTGTGCTGTCAGAGCCAACGGC
CTCTACCCCGTGGCAAATAACAGAAATGCCTTCTGGCACTGCGTGAATGGAGTCACGTAC
CAGCAGAACTGCCAGGCCGGGCTTGTCTTCGACACCAGCTGTGATTGCTGCAACTGGGCA
TAA
Protein Properties
Number of Residues 420
Molecular Weight 45461.2
Theoretical pI 4.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Chitinase, acidic
ETSSSVHEQVADSGAQAVAFQSGGESSIVWNSQLKTLLAIGGWNFGTAPFTAMVSTPENR
QTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKP
RLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTG
SNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAK
ESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGG
AMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSG
SSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
GenBank ID Protein 56205871
UniProtKB/Swiss-Prot ID Q5VUV5
UniProtKB/Swiss-Prot Entry Name Q5VUV5_HUMAN
PDB IDs Not Available
GenBank Gene ID AL356387
GeneCard ID CHIA
GenAtlas ID CHIA
HGNC ID HGNC:17432
References
General References Not Available