Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10885
Secondary Accession Numbers
  • 17184
Name Metallothionein-1E
Synonyms
  1. MT-1E
  2. MT-IE
  3. Metallothionein-IE
Gene Name MT1E
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs MT1E
Gene Sequence
>186 bp
ATGGACCCCAACTGCTCTTGCGCCACTGGTGGCTCCTGCACGTGCGCCGGCTCCTGCAAG
TGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGTTCCTGCTGCCCCGTGGGC
TGTGCCAAGTGTGCCCAGGGCTGTGTCTGCAAAGGGGCATCGGAGAAGTGCAGCTGCTGT
GCCTGA
Protein Properties
Number of Residues 61
Molecular Weight 6014.1
Theoretical pI 8.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Metallothionein-1E
MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC
A
GenBank ID Protein 54292710
UniProtKB/Swiss-Prot ID P04732
UniProtKB/Swiss-Prot Entry Name MT1E_HUMAN
PDB IDs
GenBank Gene ID AF348996
GeneCard ID MT1E
GenAtlas ID MT1E
HGNC ID HGNC:7397
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schmidt CJ, Jubier MF, Hamer DH: Structure and expression of two human metallothionein-I isoform genes and a related pseudogene. J Biol Chem. 1985 Jun 25;260(12):7731-7. [PubMed:2581970 ]
  3. Hunziker PE: Amino acid sequence determination. Methods Enzymol. 1991;205:421-6. [PubMed:1779803 ]
  4. Pauwels M, van Weyenbergh J, Soumillion A, Proost P, De Ley M: Induction by zinc of specific metallothionein isoforms in human monocytes. Eur J Biochem. 1994 Feb 15;220(1):105-10. [PubMed:8119276 ]