Hmdb loader
Identification
HMDB Protein ID HMDBP10886
Secondary Accession Numbers
  • 17185
Name Metallothionein-1F
Synonyms
  1. MT-1F
  2. MT-IF
  3. Metallothionein-IF
Gene Name MT1F
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs MT1F
Gene Sequence
>186 bp
ATGGACCCCAACTGCTCCTGCGCCGCTGGTGTCTCCTGCACCTGCGCTGGTTCCTGCAAG
TGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCCGTGGGC
TGTAGCAAGTGTGCCCAGGGCTGTGTTTGCAAAGGGGCGTCAGAGAAGTGCAGCTGCTGC
GACTGA
Protein Properties
Number of Residues 61
Molecular Weight 6086.1
Theoretical pI 7.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Metallothionein-1F
MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC
D
GenBank ID Protein 28866947
UniProtKB/Swiss-Prot ID P04733
UniProtKB/Swiss-Prot Entry Name MT1F_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005949.3
GeneCard ID MT1F
GenAtlas ID MT1F
HGNC ID HGNC:7398
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schmidt CJ, Jubier MF, Hamer DH: Structure and expression of two human metallothionein-I isoform genes and a related pseudogene. J Biol Chem. 1985 Jun 25;260(12):7731-7. [PubMed:2581970 ]
  3. Varshney U, Jahroudi N, Foster R, Gedamu L: Structure, organization, and regulation of human metallothionein IF gene: differential and cell-type-specific expression in response to heavy metals and glucocorticoids. Mol Cell Biol. 1986 Jan;6(1):26-37. [PubMed:3023827 ]
  4. Gedamu L, Varshney U, Jahroudi N, Foster R, Shworak NW: Structure and expression of the human metallothionein genes. Experientia Suppl. 1987;52:361-72. [PubMed:2444457 ]