Hmdb loader

Showing Protein Metallothionein-1G (HMDBP10887)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP10887
Secondary Accession Numbers
  • 17186
Name Metallothionein-1G
Synonyms
  1. MT-1G
  2. MT-1K
  3. MT-IG
  4. Metallothionein-1K
  5. Metallothionein-IG
Gene Name MT1G
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs MT1G
Gene Sequence 
>189 bp
ATGGACCCCAACTGCTCCTGTGCCGCTGCAGGTGTCTCCTGCACCTGCGCCAGCTCCTGC
AAGTGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCTGTG
GGCTGTGCCAAGTGTGCCCAGGGCTGCATCTGCAAAGGGGCATCGGAGAAGTGCAGCTGC
TGCGCCTGA
Protein Properties
Number of Residues 62
Molecular Weight 6141.2
Theoretical pI 8.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Metallothionein-1G
MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
CA
GenBank ID Protein 18089134
UniProtKB/Swiss-Prot ID P13640
UniProtKB/Swiss-Prot Entry Name MT1G_HUMAN
PDB IDs Not Available
GenBank Gene ID BC020757
GeneCard ID MT1G
GenAtlas ID MT1G
HGNC ID HGNC:7399
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Pauwels M, van Weyenbergh J, Soumillion A, Proost P, De Ley M: Induction by zinc of specific metallothionein isoforms in human monocytes. Eur J Biochem. 1994 Feb 15;220(1):105-10. [PubMed:8119276 ]
  3. Gedamu L, Varshney U, Jahroudi N, Foster R, Shworak NW: Structure and expression of the human metallothionein genes. Experientia Suppl. 1987;52:361-72. [PubMed:2444457 ]
  4. Foster R, Jahroudi N, Varshney U, Gedamu L: Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals. J Biol Chem. 1988 Aug 15;263(23):11528-35. [PubMed:3403543 ]