Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10893
Secondary Accession Numbers
  • 17192
Name Metallothionein-1B
Synonyms
  1. MT-1B
  2. MT-IB
  3. Metallothionein-IB
Gene Name MT1B
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q13
SNPs MT1B
Gene Sequence
>186 bp
ATGGATCCCAACTGCTCCTGCACCACAGGTGGCTCCTGTGCCTGCGCCGGCTCCTGCAAG
TGCAAAGAGTGCAAATGTACCTCCTGCAAGAAGTGCTGCTGCTCTTGCTGCCCCGTGGGC
TGTGCCAAGTGTGCCCAGGGCTGTGTCTGCAAAGGCTCATCAGAGAAGTGCCGCTGCTGT
GCCTGA
Protein Properties
Number of Residues 61
Molecular Weight 6115.2
Theoretical pI 8.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Metallothionein-1B
MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCC
A
GenBank ID Protein 27362959
UniProtKB/Swiss-Prot ID P07438
UniProtKB/Swiss-Prot Entry Name MT1B_HUMAN
PDB IDs Not Available
GenBank Gene ID AY168638
GeneCard ID MT1B
GenAtlas ID MT1B
HGNC ID HGNC:7394
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heguy A, West A, Richards RI, Karin M: Structure and tissue-specific expression of the human metallothionein IB gene. Mol Cell Biol. 1986 Jun;6(6):2149-57. [PubMed:3785191 ]