You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10905
Secondary Accession Numbers
  • 17206
Name Zinc finger protein 224
Synonyms
  1. BMZF-2
  2. Bone marrow zinc finger 2
  3. Zinc finger protein 233
  4. Zinc finger protein 255
  5. Zinc finger protein 27
  6. Zinc finger protein KOX22
Gene Name ZNF224
Protein Type Unknown
Biological Properties
General Function Involved in nucleic acid binding
Specific Function May be involved in transcriptional regulation as a transcriptional repressor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.2
SNPs ZNF224
Gene Sequence
>2124 bp
ATGACCACGTTCAAGGAGGCAATGACCTTCAAGGACGTGGCTGTGGTCTTCACTGAGGAA
GAGCTGGGGCTGCTGGACCTTGCTCAGAGGAAGCTGTATCGAGATGTGATGCTGGAGAAC
TTCAGGAACCTGCTCTCAGTGGGACATCAAGCATTCCACAGGGATACTTTCCACTTCCTA
AGGGAAGAAAAGATTTGGATGATGAAGACAGCAATCCAAAGGGAAGGGAATTCAGGAGAC
AAGATCCAAACTGAGATGGAGACTGTTTCAGAAGCAGGAACACATCAAGAGTGGTCCTTC
CAGCAAATCTGGGAAAAAATTGCAAGTGATTTAACCAGGTCTCAAGACTTGATGATAAAT
AGCTCTCAGTTCTCCAAAGAAGGTGATTTCCCCTGCCAGACTGAGGCAGGACTATCTGTA
ATTCACACAAGACAGAAATCTTCCCAGGGCAATGGATATAAACCATCCTTCAGTGATGTC
TCCCACTTTGATTTTCATCAACAATTACACTCAGGAGAGAAATCTCATACGTGTGATGAG
TGTGGAAAGAACTTTTGTTACATCTCAGCCCTTCGTATTCATCAGAGAGTCCACATGGGA
GAGAAATGCTATAAGTGTGACGTGTGTGGTAAGGAATTCAGTCAGAGTTCACATCTGCAA
ACTCATCAGAGAGTCCACACTGGAGAGAAACCGTTCAAATGTGTGGAATGTGGGAAAGGC
TTCAGTCGTAGATCAGCACTTAATGTTCATCATAAATTACACACAGGAGAGAAACCTTAT
AATTGTGAGGAATGCGGGAAGGCCTTCATTCACGATTCCCAGCTTCAAGAACATCAGAGA
ATCCATACGGGGGAGAAGCCATTCAAATGTGATATATGTGGTAAGAGCTTCTGTGGTAGA
TCAAGACTTAATAGGCATTCCATGGTTCACACGGCAGAGAAACCATTCCGATGTGATACG
TGTGATAAGAGCTTTCGTCAGAGATCAGCACTTAATAGTCATCGCATGATCCACACAGGA
GAGAAACCATACAAATGTGAGGAGTGTGGAAAAGGCTTTATTTGTAGGCGAGATCTTTAT
ACGCATCATATGGTCCACACGGGAGAAAAGCCATATAATTGTAAAGAGTGTGGGAAGAGC
TTCAGATGGGCCTCGTGTCTTTTGAAACATCAGCGAGTCCACAGTGGAGAAAAACCATTC
AAATGTGAAGAATGTGGGAAAGGATTTTACACAAATTCACAATGCTATTCCCACCAGAGA
TCCCATAGTGGAGAAAAACCATACAAATGTGTGGAGTGTGGGAAGGGCTACAAAAGGAGG
TTGGATCTTGACTTTCACCAGCGCGTCCATACAGGAGAGAAACTGTATAATTGTAAGGAA
TGTGGGAAGAGCTTTAGTCGGGCCCCATGTCTTTTGAAACATGAGAGACTCCACAGTGGA
GAAAAACCATTCCAATGTGAAGAGTGTGGGAAGAGATTTACTCAAAATTCACATCTTCAT
TCCCATCAGAGAGTTCACACTGGAGAAAAGCCATACAAATGTGAGAAGTGTGGAAAGGGC
TACAATAGTAAGTTTAATCTTGATATGCACCAGAAGGTCCACACAGGAGAGAGACCATAC
AATTGTAAGGAATGTGGGAAGAGTTTTGGCTGGGCCTCGTGTCTTTTGAAACATCAGAGA
CTGCACAGTGGAGAAAAACCATTCAAATGTGAAGAGTGTGGGAAAAGATTTACTCAGAAT
TCACAGCTTCATTCTCATCAAAGAGTGCACACTGGAGAAAAGCCATACAAATGTGATGAG
TGTGGGAAGGGCTTCAGCTGGTCCTCAACTCGTCTGACCCATCAGAGACGCCACAGCAGA
GAAACACCTCTCAAATGTGAGCAGCATGGGAAGAACATTGTACAGAATTCATTCTCTAAA
GTGCAAGAAAAAGTTCACAGTGTAGAAAAGCCATACAAATGTGAGGACTGTGGGAAGGGC
TACAACAGGCGCTTGAATCTTGATATGCATCAGAGGGTCCACATGGGAGAGAAAACATGG
AAGTGTAGGGAGTGTGATATGTGCTTTAGTCAGGCCTCAAGCCTTCGACTTCATCAGAAT
GTTCATGTTGGAGAAAAACCTTAG
Protein Properties
Number of Residues 707
Molecular Weight 82247.8
Theoretical pI 8.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 224
MTTFKEAMTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQAFHRDTFHFL
REEKIWMMKTAIQREGNSGDKIQTEMETVSEAGTHQEWSFQQIWEKIASDLTRSQDLVIN
SSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDE
CGKNFCYISALRIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPFKCVECGKG
FSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCGR
SRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECGKGFICRRDLY
THHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSG
EKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPY
NCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
CGKGFSWSSTRLTHQRRHSRETPLKCEQHGKNIVQNSFSKVQEKVHSVEKPYKCEDCGKG
YNRRLNLDMHQRVHMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKP
GenBank ID Protein 289547615
UniProtKB/Swiss-Prot ID Q9NZL3
UniProtKB/Swiss-Prot Entry Name ZN224_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_013398.2
GeneCard ID ZNF224
GenAtlas ID ZNF224
HGNC ID HGNC:13017
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  4. Han ZG, Zhang QH, Ye M, Kan LX, Gu BW, He KL, Shi SL, Zhou J, Fu G, Mao M, Chen SJ, Yu L, Chen Z: Molecular cloning of six novel Kruppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB. J Biol Chem. 1999 Dec 10;274(50):35741-8. [PubMed:10585455 ]
  5. Thiesen HJ: Multiple genes encoding zinc finger domains are expressed in human T cells. New Biol. 1990 Apr;2(4):363-74. [PubMed:2288909 ]
  6. Shannon M, Hamilton AT, Gordon L, Branscomb E, Stubbs L: Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters. Genome Res. 2003 Jun;13(6A):1097-110. Epub 2003 May 12. [PubMed:12743021 ]
  7. Lee TH, Lwu S, Kim J, Pelletier J: Inhibition of Wilms tumor 1 transactivation by bone marrow zinc finger 2, a novel transcriptional repressor. J Biol Chem. 2002 Nov 22;277(47):44826-37. Epub 2002 Sep 17. [PubMed:12239212 ]