Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10907
Secondary Accession Numbers
  • 17208
Name Zinc finger and BTB domain-containing protein 16
Synonyms
  1. Promyelocytic leukemia zinc finger protein
  2. Zinc finger protein 145
  3. Zinc finger protein PLZF
Gene Name ZBTB16
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Probable transcription factor. May play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues. Probable substrate-recognition component of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 11q23.1
SNPs ZBTB16
Gene Sequence
>2022 bp
ATGGATCTGACAAAAATGGGCATGATCCAGCTGCAGAACCCTAGCCACCCCACGGGGCTA
CTGTGCAAGGCCAACCAGATGCGGCTGGCCGGGACTTTGTGCGATGTGGTCATCATGGTG
GACAGCCAGGAGTTCCACGCCCACCGGACGGTGCTGGCCTGCACCAGCAAGATGTTTGAG
ATCCTCTTCCACCGCAATAGTCAACACTATACTTTGGACTTCCTCTCGCCAAAGACCTTC
CAGCAGATTCTGGAGTATGCATATACAGCCACGCTGCAAGCCAAGGCGGAGGACCTGGAT
GACCTGCTGTATGCGGCCGAGATCCTGGAGATCGAGTACCTGGAGGAACAGTGCCTGAAG
ATGCTGGAGACCATCCAGGCCTCAGACGACAATGACACGGAGGCCACCATGGCCGATGGC
GGGGCCGAGGAAGAAGAGGACCGCAAGGCTCGGTACCTCAAGAACATCTTCATCTCGAAG
CATTCCAGCGAGGAGAGTGGGTATGCCAGTGTGGCTGGACAGAGCCTCCCTGGGCCCATG
GTGGACCAGAGCCCTTCAGTCTCCACTTCATTTGGTCTTTCAGCCATGAGTCCCACCAAG
GCTGCAGTGGACAGTTTGATGACCATAGGACAGTCTCTCCTGCAGGGAACTCTTCAGCCA
CCTGCAGGGCCCGAGGAGCCAACTCTGGCTGGGGGTGGGCGGCACCCTGGGGTGGCTGAG
GTGAAGACGGAGATGATGCAGGTGGATGAGGTGCCCAGCCAGGACAGCCCTGGGGCAGCC
GAGTCCAGCATCTCAGGAGGGATGGGGGACAAGGTTGAGGAAAGAGGCAAAGAGGGGCCT
GGGACCCCGACTCGAAGCAGCGTCATCACCAGTGCTAGGGAGCTACACTATGGGCGAGAG
GAGAGTGCCGAGCAGGTGCCACCCCCAGCTGAGGCTGGCCAGGCCCCCACTGGCCGACCT
GAGCACCCAGCACCCCCGCCTGAGAAGCATCTGGGCATCTACTCCGTGTTGCCCAACCAC
AAGGCTGACGCTGTATTGAGCATGCCGTCTTCCGTGACCTCTGGCCTCCACGTGCAGCCT
GCCCTGGCTGTCTCCATGGACTTCAGCACCTATGGGGGGCTGCTGCCCCAGGGCTTCATC
CAGAGGGAGCTGTTCAGCAAGCTGGGGGAGCTGGCTGTGGGCATGAAGTCAGAGAGCCGG
ACCATCGGAGAGCAGTGCAGCGTGTGTGGGGTCGAGCTTCCTGATAACGAGGCTGTGGAG
CAGCACAGGAAGCTGCACAGTGGGATGAAGACGTACGGGTGCGAGCTCTGCGGGAAGCGG
TTCCTGGATAGTTTGCGGCTGAGAATGCACTTACTGGCTCATTCAGCGGGTGCCAAAGCC
TTTGTCTGTGATCAGTGCGGTGCACAGTTTTCGAAGGAGGATGCCCTGGAGACACACAGG
CAGACCCATACTGGCACTGACATGGCCGTCTTCTGTCTGCTGTGTGGGAAGCGCTTCCAG
GCGCAGAGCGCACTGCAGCAGCACATGGAGGTCCACGCGGGCGTGCGCAGCTACATCTGC
AGTGAGTGCAACCGCACCTTCCCCAGCCACACGGCTCTCAAACGCCACCTGCGCTCACAT
ACAGGCGACCACCCCTACGAGTGTGAGTTCTGTGGCAGCTGCTTCCGGGATGAGAGCACA
CTCAAGAGCCACAAACGCATCCACACGGGTGAGAAACCCTACGAGTGCAATGGCTGTGGC
AAGAAGTTCAGCCTCAAGCATCAGCTGGAGACGCACTATAGGGTGCACACAGGTGAGAAG
CCCTTTGAGTGTAAGCTCTGCCACCAGCGCTCCCGGGACTACTCGGCCATGATCAAGCAC
CTGAGAACGCACAACGGCGCCTCGCCCTACCAGTGCACCATCTGCACAGAGTACTGCCCC
AGCCTCTCCTCCATGCAGAAGCACATGAAGGGCCACAAGCCCGAGGAGATCCCGCCCGAC
TGGAGGATAGAGAAGACGTACCTCTACCTGTGCTATGTGTGA
Protein Properties
Number of Residues 673
Molecular Weight 74273.5
Theoretical pI 6.45
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger and BTB domain-containing protein 16
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
GenBank ID Protein 4138922
UniProtKB/Swiss-Prot ID Q05516
UniProtKB/Swiss-Prot Entry Name ZBT16_HUMAN
PDB IDs
GenBank Gene ID AF060568
GeneCard ID ZBTB16
GenAtlas ID ZBTB16
HGNC ID HGNC:12930
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chen Z, Brand NJ, Chen A, Chen SJ, Tong JH, Wang ZY, Waxman S, Zelent A: Fusion between a novel Kruppel-like zinc finger gene and the retinoic acid receptor-alpha locus due to a variant t(11;17) translocation associated with acute promyelocytic leukaemia. EMBO J. 1993 Mar;12(3):1161-7. [PubMed:8384553 ]
  3. Zhang T, Xiong H, Kan LX, Zhang CK, Jiao XF, Fu G, Zhang QH, Lu L, Tong JH, Gu BW, Yu M, Liu JX, Licht J, Waxman S, Zelent A, Chen E, Chen SJ: Genomic sequence, structural organization, molecular evolution, and aberrant rearrangement of promyelocytic leukemia zinc finger gene. Proc Natl Acad Sci U S A. 1999 Sep 28;96(20):11422-7. [PubMed:10500192 ]
  4. Chen SJ, Zelent A, Tong JH, Yu HQ, Wang ZY, Derre J, Berger R, Waxman S, Chen Z: Rearrangements of the retinoic acid receptor alpha and promyelocytic leukemia zinc finger genes resulting from t(11;17)(q23;q21) in a patient with acute promyelocytic leukemia. J Clin Invest. 1993 May;91(5):2260-7. [PubMed:8387545 ]
  5. Hoatlin ME, Zhi Y, Ball H, Silvey K, Melnick A, Stone S, Arai S, Hawe N, Owen G, Zelent A, Licht JD: A novel BTB/POZ transcriptional repressor protein interacts with the Fanconi anemia group C protein and PLZF. Blood. 1999 Dec 1;94(11):3737-47. [PubMed:10572087 ]
  6. Itoh T, Koshiba S, Kigawa T, Kikuchi A, Yokoyama S, Takenawa T: Role of the ENTH domain in phosphatidylinositol-4,5-bisphosphate binding and endocytosis. Science. 2001 Feb 9;291(5506):1047-51. [PubMed:11161217 ]
  7. Furukawa M, He YJ, Borchers C, Xiong Y: Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases. Nat Cell Biol. 2003 Nov;5(11):1001-7. Epub 2003 Oct 5. [PubMed:14528312 ]
  8. Ahmad KF, Engel CK, Prive GG: Crystal structure of the BTB domain from PLZF. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12123-8. [PubMed:9770450 ]
  9. Li X, Peng H, Schultz DC, Lopez-Guisa JM, Rauscher FJ 3rd, Marmorstein R: Structure-function studies of the BTB/POZ transcriptional repression domain from the promyelocytic leukemia zinc finger oncoprotein. Cancer Res. 1999 Oct 15;59(20):5275-82. [PubMed:10537309 ]
  10. Fischer S, Kohlhase J, Bohm D, Schweiger B, Hoffmann D, Heitmann M, Horsthemke B, Wieczorek D: Biallelic loss of function of the promyelocytic leukaemia zinc finger (PLZF) gene causes severe skeletal defects and genital hypoplasia. J Med Genet. 2008 Nov;45(11):731-7. doi: 10.1136/jmg.2008.059451. Epub 2008 Jul 8. [PubMed:18611983 ]